| Clone Name | rbaet77a10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q300_MOUSE (Q02722) Protein Q300 | 32 | 0.59 | 2 | CR023_HUMAN (Q8NB54) Protein C18orf23 | 30 | 2.2 | 3 | SEPT3_MOUSE (Q9Z1S5) Neuronal-specific septin-3 | 29 | 2.9 | 4 | YE85_SCHPO (O14301) Hypothetical WD-repeat protein C9G1.05 in ch... | 28 | 8.5 |
|---|
>Q300_MOUSE (Q02722) Protein Q300| Length = 77 Score = 31.6 bits (70), Expect = 0.59 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -3 Query: 90 WFSYTKIMYACVCQCVCLFRCI 25 W T + Y CVC CVC+ C+ Sbjct: 18 WEGETNLFYVCVCVCVCVCVCV 39
>CR023_HUMAN (Q8NB54) Protein C18orf23| Length = 160 Score = 29.6 bits (65), Expect = 2.2 Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 3/28 (10%) Frame = -3 Query: 99 CRCW---FSYTKIMYACVCQCVCLFRCI 25 C C ++ ++ + ACVC CVCL+ C+ Sbjct: 42 CLCMTVAYTGSRCLGACVCVCVCLYVCV 69
>SEPT3_MOUSE (Q9Z1S5) Neuronal-specific septin-3| Length = 465 Score = 29.3 bits (64), Expect = 2.9 Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 3/34 (8%) Frame = -3 Query: 93 CWF--SYTKIMYACVCQCVCLFRCI-INK*LCVF 1 CW+ S + CVC CVC++ C+ + + CV+ Sbjct: 362 CWYLCSILSSVCVCVCVCVCMYVCMCVMESACVY 395
>YE85_SCHPO (O14301) Hypothetical WD-repeat protein C9G1.05 in chromosome I| Length = 595 Score = 27.7 bits (60), Expect = 8.5 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 3/51 (5%) Frame = +1 Query: 25 YTPKQTHTLT---HTRIHNFSIRKPTTALAMRS*ISIGG*DMEPANYHALL 168 + K TH T T IH +S+ +P +AM++ S+G +E + + LL Sbjct: 530 WNAKSTHLATASLDTNIHIYSVERPMKYIAMKNAHSLGATQVEWVSENELL 580 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,151,279 Number of Sequences: 219361 Number of extensions: 455103 Number of successful extensions: 780 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 746 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 774 length of database: 80,573,946 effective HSP length: 46 effective length of database: 70,483,340 effective search space used: 1691600160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)