| Clone Name | rbaet76h08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ATP7A_CRIGR (P49015) Copper-transporting ATPase 1 (EC 3.6.3.4) (... | 29 | 3.6 | 2 | SYI_YERPS (Q66ES4) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isole... | 28 | 8.0 | 3 | SYI_YERPE (Q8ZIM0) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isole... | 28 | 8.0 |
|---|
>ATP7A_CRIGR (P49015) Copper-transporting ATPase 1 (EC 3.6.3.4) (Copper pump 1)| (Fragment) Length = 1476 Score = 28.9 bits (63), Expect = 3.6 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -3 Query: 253 HIHTYI*INALILSSCGIYIERDREREDGVSMLSQFCMAG 134 H YI ++ + +SC IER+ RE+G+ + MAG Sbjct: 477 HSKCYIQVSGMTCASCVANIERNLRREEGIYSVLVALMAG 516
>SYI_YERPS (Q66ES4) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 938 Score = 27.7 bits (60), Expect = 8.0 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 203 DIYRERQRERGRSIYVEPVLHGRPYCSIH 117 D+ E RE+G ++VE +LH P C H Sbjct: 381 DVVVELLREKGALLHVEKLLHSYPCCWRH 409
>SYI_YERPE (Q8ZIM0) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 938 Score = 27.7 bits (60), Expect = 8.0 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 203 DIYRERQRERGRSIYVEPVLHGRPYCSIH 117 D+ E RE+G ++VE +LH P C H Sbjct: 381 DVVVELLREKGALLHVEKLLHSYPCCWRH 409 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,808,081 Number of Sequences: 219361 Number of extensions: 807829 Number of successful extensions: 1670 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1653 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1670 length of database: 80,573,946 effective HSP length: 65 effective length of database: 66,315,481 effective search space used: 1591571544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)