| Clone Name | rbaet76g11 |
|---|---|
| Clone Library Name | barley_pub |
>HBP1A_WHEAT (P23922) Transcription factor HBP-1a (Histone-specific| transcription factor HBP1) Length = 349 Score = 29.3 bits (64), Expect = 2.8 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = +1 Query: 103 NGDPPLPSPASRKETEEQPDAGARSXXXXXXXXEWPG 213 + DP PS AS+ +EQP A S EWPG Sbjct: 3 SNDPSTPSKASKPPEQEQPPA-TTSGTTAPVYPEWPG 38
>LGB3_MEDSA (P14962) Leghemoglobin-3 (Leghemoglobin III)| Length = 146 Score = 28.9 bits (63), Expect = 3.7 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = -1 Query: 212 PGHSVLVLVLVLERAPASGCSSVSFLEAGEGRGGSP 105 PG+SVL ++LE+APA+ SFL+ G SP Sbjct: 22 PGNSVLFYTIILEKAPAAK-GMFSFLKDSAGVQDSP 56
>TAI12_MOUSE (Q8BGQ2) TGF-beta-induced apoptosis protein 12 (TAIP-12)| Length = 534 Score = 28.1 bits (61), Expect = 6.3 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = -1 Query: 227 RAVLPPGHSVLVLVLVLERAPASGCSSVSFLEAG 126 +A LPPG SVL E AS SS S+L +G Sbjct: 374 QAQLPPGSSVLCFTENSEHPAASPMSSPSYLNSG 407
>LGB1_PEA (P02233) Leghemoglobin-1 (Leghemoglobin I)| Length = 147 Score = 28.1 bits (61), Expect = 6.3 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = -1 Query: 212 PGHSVLVLVLVLERAPASGCSSVSFLEAGEGRGGSP 105 PG+S+L +VLE+APA+ SFL+ G SP Sbjct: 21 PGYSILFYTIVLEKAPAAK-GLFSFLKDTAGVEDSP 55
>TRPE_AERPE (Q9Y8T0) Anthranilate synthase component 1 (EC 4.1.3.27)| (Anthranilate synthase component I) Length = 438 Score = 28.1 bits (61), Expect = 6.3 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = +1 Query: 106 GDPPLPSPASRKET 147 GD PLP+PASRKE+ Sbjct: 145 GDTPLPAPASRKES 158
>LGB2_MEDTR (P27993) Leghemoglobin 2| Length = 146 Score = 28.1 bits (61), Expect = 6.3 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = -1 Query: 212 PGHSVLVLVLVLERAPASGCSSVSFLEAGEGRGGSP 105 PG+SVL ++LE+APA+ SFL+ G SP Sbjct: 22 PGNSVLFYTIILEKAPAAK-GMFSFLKDTAGVQDSP 56
>CAC1A_RAT (P54282) Voltage-dependent P/Q-type calcium channel alpha-1A subunit| (Voltage-gated calcium channel alpha subunit Cav2.1) (Calcium channel, L type, alpha-1 polypeptide, isoform 4) (Brain calcium channel I) (BI) (RAT brain class A) (RBA-I) Length = 2212 Score = 27.7 bits (60), Expect = 8.3 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 91 VNKNNGDPPLPSPASRKETEEQPDAG 168 VNKN PLP K+ EE+ D G Sbjct: 1137 VNKNANPDPLPKKEEEKKEEEEADPG 1162
>CAC1A_MOUSE (P97445) Voltage-dependent P/Q-type calcium channel alpha-1A subunit| (Voltage-gated calcium channel alpha subunit Cav2.1) (Calcium channel, L type, alpha-1 polypeptide isoform 4) (Brain calcium channel I) (BI) Length = 2164 Score = 27.7 bits (60), Expect = 8.3 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 91 VNKNNGDPPLPSPASRKETEEQPDAG 168 VNKN PLP K+ EE+ D G Sbjct: 1089 VNKNANPDPLPKKEEEKKEEEEADPG 1114
>CAC1A_HUMAN (O00555) Voltage-dependent P/Q-type calcium channel alpha-1A subunit| (Voltage-gated calcium channel alpha subunit Cav2.1) (Calcium channel, L type, alpha-1 polypeptide isoform 4) (Brain calcium channel I) (BI) Length = 2505 Score = 27.7 bits (60), Expect = 8.3 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 91 VNKNNGDPPLPSPASRKETEEQPDAG 168 VNKN PLP K+ EE+ D G Sbjct: 1186 VNKNANPDPLPKKEEEKKEEEEDDRG 1211 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.313 0.132 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,098,823 Number of Sequences: 219361 Number of extensions: 469373 Number of successful extensions: 1001 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 985 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1000 length of database: 80,573,946 effective HSP length: 55 effective length of database: 68,509,091 effective search space used: 1644218184 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)