| Clone Name | rbaet76d10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CSPG2_BOVIN (P81282) Versican core protein precursor (Large fibr... | 32 | 0.54 | 2 | BOLA_HAEIN (P43780) Protein bolA homolog | 30 | 2.1 | 3 | ZN287_MOUSE (Q9EQB9) Zinc finger protein 287 (Zfp-287) (Zinc fin... | 28 | 4.6 | 4 | BARD1_RAT (Q9QZH2) BRCA1-associated RING domain protein 1 (BARD-1) | 28 | 7.9 |
|---|
>CSPG2_BOVIN (P81282) Versican core protein precursor (Large fibroblast| proteoglycan) (Chondroitin sulfate proteoglycan core protein 2) (PG-M) (Glial hyaluronate-binding protein) (GHAP) Length = 3381 Score = 31.6 bits (70), Expect = 0.54 Identities = 18/42 (42%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = +2 Query: 26 VSK-ITSVPPQTSPNHMKG--FGGYNATREVTRYSHTPHTIP 142 VSK +++VP P+ ++G F Y++T+E T Y T HTIP Sbjct: 942 VSKPLSTVPQFAHPSDVEGSTFVNYSSTQEPTTYVDTSHTIP 983
>BOLA_HAEIN (P43780) Protein bolA homolog| Length = 103 Score = 29.6 bits (65), Expect = 2.1 Identities = 11/32 (34%), Positives = 22/32 (68%) Frame = +1 Query: 58 ISQSYERIRGLQRNKGSYKILSHTTHHSMHVL 153 +S ++ IR +QR++ Y++L+ +HS+H L Sbjct: 44 VSADFKNIRKVQRHQRIYQLLNEELNHSIHAL 75
>ZN287_MOUSE (Q9EQB9) Zinc finger protein 287 (Zfp-287) (Zinc finger protein| SKAT-2) Length = 759 Score = 28.5 bits (62), Expect = 4.6 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +3 Query: 24 WSPK*QV-CPHKHLPII*KDSGVTTQQGKLQDT 119 W PK Q CP KHLP + +D TQ KL+D+ Sbjct: 236 WEPKAQAQCPAKHLPELKQDG---TQTVKLEDS 265
>BARD1_RAT (Q9QZH2) BRCA1-associated RING domain protein 1 (BARD-1)| Length = 768 Score = 27.7 bits (60), Expect = 7.9 Identities = 14/48 (29%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Frame = +3 Query: 6 ITKHCSWSPK*QVCPHKHLPII*KDSGVTTQQGKLQDTLTHH--TPFH 143 + H W+P + C H HL I+ + Q L +T +H +P H Sbjct: 446 VKDHAGWTPLHEACSHGHLKIV----ELLLQHNALVNTTGYHNDSPLH 489 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,029,725 Number of Sequences: 219361 Number of extensions: 852093 Number of successful extensions: 2065 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2029 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2065 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)