| Clone Name | rbaet76d01 |
|---|---|
| Clone Library Name | barley_pub |
>ILPR_BRALA (O02466) Insulin-like peptide receptor precursor (EC 2.7.10.1) (ILP| receptor) [Contains: Insulin-like peptide receptor alpha chain; Insulin-like peptide receptor beta chain] Length = 1363 Score = 29.3 bits (64), Expect = 2.6 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 5/51 (9%) Frame = +2 Query: 38 LHKNICS--ENNCNLQQSGDEAPTE*R---TNHQSNVTMPPAGRQLPPTPS 175 LH N+ EN + E P R +N NVT+P R +PPTP+ Sbjct: 701 LHNNVYHKRENETRAGRRRRELPVTARPFYSNQTVNVTLPSTNRTVPPTPT 751
>ACK2_BOVIN (O02742) Activated CDC42 kinase 2 (EC 2.7.10.2) (ACK-2)| Length = 747 Score = 28.9 bits (63), Expect = 3.4 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 5/48 (10%) Frame = +2 Query: 50 ICSENNCNLQQSGDEAPTE*RTNH----QSNVTMPPAGRQ-LPPTPSW 178 +CS N+ + P++ TN+ + +PPAG Q +PPTP W Sbjct: 661 VCSINSTLVGAGVSAEPSQGETNYAFVPEPARLLPPAGGQPVPPTPEW 708
>TRUA_BARHE (Q6G547) tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA-uridine| isomerase I) (tRNA pseudouridylate synthase I) Length = 247 Score = 27.7 bits (60), Expect = 7.5 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 16 SISSALKTAQEHLLGEQLQLTTIGR 90 +I SAL+ A H G+QL +TT GR Sbjct: 26 TIQSALEQALFHFSGQQLTITTAGR 50
>ARP6_CAEEL (Q09443) Actin-like protein C08B11.6| Length = 418 Score = 27.7 bits (60), Expect = 7.5 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 Query: 47 NICSENNCNLQQSGDEAPTE*RTNHQSNVTM 139 N C E+ C + Q+ DE+ E R Q N TM Sbjct: 203 NECKEDLCFVSQNFDESMKEARNRFQENTTM 233
>EPHB4_HUMAN (P54760) Ephrin type-B receptor 4 precursor (EC 2.7.10.1)| (Tyrosine-protein kinase receptor HTK) Length = 987 Score = 27.7 bits (60), Expect = 7.5 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = -2 Query: 267 MDWASPEEAELHRGDGFSLLVYAWKS*LASHDGVGGSCRPAGGIVTFD 124 ++W++P E+ G L YA + GGSC P GG +TFD Sbjct: 341 LEWSAPLES-----GGREDLTYALR---CRECRPGGSCAPCGGDLTFD 380 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,006,441 Number of Sequences: 219361 Number of extensions: 548435 Number of successful extensions: 1266 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1250 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1266 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)