| Clone Name | rbaet76c12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | L_SYNV (P31332) Large structural protein (L protein) (Transcript... | 32 | 0.34 | 2 | CYB_CEPNE (Q34179) Cytochrome b | 31 | 0.99 | 3 | SBCC_VIBCH (Q9KM67) Nuclease sbcCD subunit C | 28 | 4.9 | 4 | NCAP_TPMV (Q9WS40) Nucleoprotein (Protein N) (Nucleocapsid prote... | 28 | 4.9 |
|---|
>L_SYNV (P31332) Large structural protein (L protein) (Transcriptase)| (Replicase) [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 2116 Score = 32.3 bits (72), Expect = 0.34 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +3 Query: 9 KQSMYSRYYDSHMHLPRPTLVGAYIHMLVYSHMIGTRSKIE 131 K + ++ YYD H H P TL H +YS + R KIE Sbjct: 405 KLTFFTNYYDKHHHYPLSTLTHP-DHFNLYSQYLSERDKIE 444
>CYB_CEPNE (Q34179) Cytochrome b| Length = 380 Score = 30.8 bits (68), Expect = 0.99 Identities = 23/75 (30%), Positives = 35/75 (46%), Gaps = 6/75 (8%) Frame = +3 Query: 3 SCKQSMYSRYYDSHMHLPRPTLVGAYIHMLVY-----SHMIGTRSKIEKAEL-PTDQCEL 164 S Q+ +R+Y H LP LV +H+L+ S+ +G S + K P ++ Sbjct: 165 SVNQATLNRFYSFHFLLPFVILVFVLVHLLLLHDKGSSNPLGNMSHVSKVSFHPYFTWKI 224 Query: 165 TWHVYRLLQLALYAL 209 W V+ LL LY L Sbjct: 225 LW-VFVLLCFLLYVL 238
>SBCC_VIBCH (Q9KM67) Nuclease sbcCD subunit C| Length = 1013 Score = 28.5 bits (62), Expect = 4.9 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +3 Query: 117 RSKIEKAELPTDQCELTWHVYRLLQLAL 200 +++ E+A+L D+ E WH R +LAL Sbjct: 472 QTQAEQAKLTADKLEFAWHTQRAAELAL 499
>NCAP_TPMV (Q9WS40) Nucleoprotein (Protein N) (Nucleocapsid protein) (NP| protein) Length = 552 Score = 28.5 bits (62), Expect = 4.9 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = +3 Query: 105 MIGTRSKIEKAELPTDQCELTWHVYRLLQLALY--ALPDS 218 ++G RS + T L W + RLL LA+Y +LPDS Sbjct: 28 LVGVRSTVVVLVPSTKDHRLRWKLIRLLTLAVYNDSLPDS 67 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,124,303 Number of Sequences: 219361 Number of extensions: 544877 Number of successful extensions: 1119 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1119 length of database: 80,573,946 effective HSP length: 49 effective length of database: 69,825,257 effective search space used: 1675806168 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)