| Clone Name | rbaet76b04 |
|---|---|
| Clone Library Name | barley_pub |
>CDD_BACHD (Q9KD53) Cytidine deaminase (EC 3.5.4.5) (Cytidine aminohydrolase)| (CDA) Length = 132 Score = 30.0 bits (66), Expect = 1.6 Identities = 8/30 (26%), Positives = 19/30 (63%) Frame = -3 Query: 111 ICIIIIERARCPLPSCGQCKLIEPKVCPSE 22 + I ++ + P+P CG C+ + ++CP++ Sbjct: 71 VAIAVVADTKRPVPPCGACRQVMAELCPAD 100
>TRXL7_ARATH (O22779) Putative thioredoxin-like 7, chloroplast precursor| Length = 273 Score = 28.9 bits (63), Expect = 3.6 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -3 Query: 72 PSCGQCKLIEPKVC 31 PSCG CK + PK+C Sbjct: 123 PSCGGCKALHPKIC 136
>FINC_XENLA (Q91740) Fibronectin precursor (FN)| Length = 2481 Score = 28.5 bits (62), Expect = 4.7 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 8/73 (10%) Frame = +2 Query: 2 THNPSIHSLG----HTLGSINLHCPQLGRG-HLARSMMMIQINTQS---PCSYTLIHDVQ 157 T N ++SLG T GS + C LG G ++ I + PC+ HD + Sbjct: 311 TDNGVLYSLGMRWLRTQGSKQMLCTCLGNGVSCEETVATITFGGNANGEPCAIPFTHDGK 370 Query: 158 VHMHISSDGQTDG 196 + +S+G+ DG Sbjct: 371 TYYSCTSEGRQDG 383
>WWTR1_HUMAN (Q9GZV5) WW domain-containing transcription regulator protein 1| (Transcriptional coactivator with PDZ-binding motif) Length = 400 Score = 28.1 bits (61), Expect = 6.1 Identities = 11/40 (27%), Positives = 25/40 (62%) Frame = +1 Query: 37 LGLN*FTLPTARERASRSLDDDDTNKHTKSVQLHVDPRRT 156 LGL +++PT E ++D+ DT ++ ++++P++T Sbjct: 316 LGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQT 355
>LIN3_CAEEL (Q03345) Protein lin-3 precursor (Abnormal cell lineage protein 3)| (Lethal protein 94) Length = 438 Score = 28.1 bits (61), Expect = 6.1 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = +1 Query: 82 SRSLDDDDTNKHTKSV 129 SRS++DDDT KH KSV Sbjct: 346 SRSINDDDTPKHYKSV 361
>DGKE_HUMAN (P52429) Diacylglycerol kinase epsilon (EC 2.7.1.107) (Diglyceride| kinase epsilon) (DGK-epsilon) (DAG kinase epsilon) Length = 567 Score = 28.1 bits (61), Expect = 6.1 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 9/52 (17%) Frame = +2 Query: 65 QLGRGHLAR-----SMMMIQIN----TQSPCSYTLIHDVQVHMHISSDGQTD 193 ++G+ H R SMM +Q++ Q PC+ T+ H M S QTD Sbjct: 500 RIGQAHTVRLILKCSMMPMQVDGEPWAQGPCTVTITHKTHAMMLYFSGEQTD 551
>WWTR1_MOUSE (Q9EPK5) WW domain-containing transcription regulator protein 1| (Transcriptional coactivator with PDZ-binding motif) Length = 395 Score = 28.1 bits (61), Expect = 6.1 Identities = 12/40 (30%), Positives = 25/40 (62%) Frame = +1 Query: 37 LGLN*FTLPTARERASRSLDDDDTNKHTKSVQLHVDPRRT 156 LGL +++PT E ++D+ DT +++ + V+P++T Sbjct: 311 LGLGCYSVPTTPEDFLSNMDEMDTGENSGQTPMTVNPQQT 350 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,905,646 Number of Sequences: 219361 Number of extensions: 754366 Number of successful extensions: 2292 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2242 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2292 length of database: 80,573,946 effective HSP length: 66 effective length of database: 66,096,120 effective search space used: 1586306880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)