| Clone Name | rbaet76a04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | COPB_RAT (P23514) Coatomer subunit beta (Beta-coat protein) (Bet... | 30 | 1.6 | 2 | COPB_MOUSE (Q9JIF7) Coatomer subunit beta (Beta-coat protein) (B... | 30 | 1.6 | 3 | COPB_HUMAN (P53618) Coatomer subunit beta (Beta-coat protein) (B... | 30 | 1.6 | 4 | Y2658_LISIN (Q927X9) Hypothetical UPF0230 protein lin2658 | 28 | 6.2 | 5 | YR680_MIMIV (Q5UNT6) Hypothetical protein R680 | 28 | 8.1 |
|---|
>COPB_RAT (P23514) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 30.0 bits (66), Expect = 1.6 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -1 Query: 242 QILTVIH-LDSVENYRGHLWLLLAWCSTR 159 ++L V H + SV+ YRG LW+L +CST+ Sbjct: 441 KMLEVFHAIKSVKIYRGALWILGEYCSTK 469
>COPB_MOUSE (Q9JIF7) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 30.0 bits (66), Expect = 1.6 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -1 Query: 242 QILTVIH-LDSVENYRGHLWLLLAWCSTR 159 ++L V H + SV+ YRG LW+L +CST+ Sbjct: 441 KMLEVFHAIKSVKIYRGALWILGEYCSTK 469
>COPB_HUMAN (P53618) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 30.0 bits (66), Expect = 1.6 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -1 Query: 242 QILTVIH-LDSVENYRGHLWLLLAWCSTR 159 ++L V H + SV+ YRG LW+L +CST+ Sbjct: 441 KMLEVFHAIKSVKIYRGALWILGEYCSTK 469
>Y2658_LISIN (Q927X9) Hypothetical UPF0230 protein lin2658| Length = 283 Score = 28.1 bits (61), Expect = 6.2 Identities = 17/60 (28%), Positives = 33/60 (55%), Gaps = 2/60 (3%) Frame = +2 Query: 47 DNSSYIVNEVKKTVHSNTEKEN--LQNTNYCE*SGSFCTAEYYTTLRAAKDAPDSSQRYP 220 D+++Y+ +EVK+ + N + + +Y E TA++Y ++ A++ P SSQ P Sbjct: 10 DSTTYLPDEVKEQLRINVVPLSVIIDGKSYRE-GEELSTADFYKKVKEAENFPTSSQPAP 68
>YR680_MIMIV (Q5UNT6) Hypothetical protein R680| Length = 111 Score = 27.7 bits (60), Expect = 8.1 Identities = 15/55 (27%), Positives = 31/55 (56%) Frame = -1 Query: 242 QILTVIHLDSVENYRGHLWLLLAWCSTRRYKKIQIIRSSWYFVNSPSLCSNVPFS 78 +I +I D+++N++ HL + L + Y+ I++ FVN+ + + +PFS Sbjct: 56 KIKKIITKDNLDNFK-HLCINLTKNQKKYYQTKYYIKNKTLFVNNKGIFTLIPFS 109 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,488,680 Number of Sequences: 219361 Number of extensions: 586487 Number of successful extensions: 1438 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1423 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1438 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)