| Clone Name | rbaet75d04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RCAA_HORVU (Q40073) Ribulose bisphosphate carboxylase/oxygenase ... | 83 | 2e-16 | 2 | RCA_ARATH (P10896) Ribulose bisphosphate carboxylase/oxygenase a... | 64 | 8e-11 | 3 | RCA1_LARTR (Q7X9A0) Ribulose bisphosphate carboxylase/oxygenase ... | 63 | 2e-10 | 4 | RCA_SPIOL (P10871) Ribulose bisphosphate carboxylase/oxygenase a... | 60 | 1e-09 |
|---|
>RCAA_HORVU (Q40073) Ribulose bisphosphate carboxylase/oxygenase activase A,| chloroplast precursor (RuBisCO activase A) (RA A) Length = 464 Score = 82.8 bits (203), Expect = 2e-16 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -2 Query: 262 GKGAQQGTLPVPEGCPDQNAKNYDPTARNDDGSCLYTF 149 GKGAQQGTLPVPEGC DQNAKNYDPTAR+DDGSCLYTF Sbjct: 427 GKGAQQGTLPVPEGCTDQNAKNYDPTARSDDGSCLYTF 464
>RCA_ARATH (P10896) Ribulose bisphosphate carboxylase/oxygenase activase,| chloroplast precursor (RuBisCO activase) (RA) Length = 474 Score = 64.3 bits (155), Expect = 8e-11 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -2 Query: 262 GKGAQQGTLPVPEGCPDQNAKNYDPTARNDDGSCLYTF 149 GKGAQQ LPVPEGC D A+N+DPTAR+DDG+C+Y F Sbjct: 437 GKGAQQVNLPVPEGCTDPVAENFDPTARSDDGTCVYNF 474
>RCA1_LARTR (Q7X9A0) Ribulose bisphosphate carboxylase/oxygenase activase 1,| chloroplast precursor (RuBisCO activase 1) (RA 1) (RubisCO activase alpha form) Length = 476 Score = 63.2 bits (152), Expect = 2e-10 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 1/40 (2%) Frame = -2 Query: 265 GGKGAQQ-GTLPVPEGCPDQNAKNYDPTARNDDGSCLYTF 149 GG+ AQQ G +PVPEGC D A NYDPTAR+DDGSC+Y F Sbjct: 437 GGQAAQQVGNVPVPEGCTDPQATNYDPTARSDDGSCVYKF 476
>RCA_SPIOL (P10871) Ribulose bisphosphate carboxylase/oxygenase activase,| chloroplast precursor (RuBisCO activase) (RA) Length = 472 Score = 60.5 bits (145), Expect = 1e-09 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -2 Query: 262 GKGAQQGTLPVPEGCPDQNAKNYDPTARNDDGSCLY 155 GK AQQ +LPV +GC D AKNYDPTAR+DDGSC Y Sbjct: 435 GKAAQQVSLPVAQGCTDPEAKNYDPTARSDDGSCTY 470 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,562,861 Number of Sequences: 219361 Number of extensions: 679327 Number of successful extensions: 1875 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1841 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1875 length of database: 80,573,946 effective HSP length: 66 effective length of database: 66,096,120 effective search space used: 1586306880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)