| Clone Name | rbaet75d01 |
|---|---|
| Clone Library Name | barley_pub |
>APC_MOUSE (Q61315) Adenomatous polyposis coli protein (Protein APC) (mAPC)| Length = 2845 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -1 Query: 216 TESSGANRMAYTSPG*Q*SNQ 154 T+SSG+ +M+YTSPG Q S Q Sbjct: 2356 TKSSGSGKMSYTSPGRQLSQQ 2376
>APC_HUMAN (P25054) Adenomatous polyposis coli protein (Protein APC)| Length = 2843 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -1 Query: 216 TESSGANRMAYTSPG*Q*SNQ 154 T+SSG+ +M+YTSPG Q S Q Sbjct: 2356 TKSSGSGKMSYTSPGRQMSQQ 2376
>LEU2_CANMA (Q00464) 3-isopropylmalate dehydratase (EC 4.2.1.33)| (Isopropylmalate isomerase) (Alpha-IPM isomerase) (IPMI) Length = 770 Score = 29.3 bits (64), Expect = 2.6 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = +1 Query: 106 NCYNNILLPINSKEETLVASLLPRRSVGHSVRT*GLRISIPGRQLQ 243 N + N LLPI ++ + + L+P GH L I +P +Q++ Sbjct: 652 NSFKNFLLPIRIPQDVIESKLVPVVKAGHK-----LTIDLPNQQIK 692
>APC_RAT (P70478) Adenomatous polyposis coli protein (Protein APC)| Length = 2842 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -1 Query: 216 TESSGANRMAYTSPG*Q*SNQ 154 T+SSG+ +M+YTSPG Q S Q Sbjct: 2356 TKSSGSGKMSYTSPGRQLSQQ 2376
>APC_XENLA (P70039) Adenomatous polyposis coli homolog (Protein APC)| Length = 2829 Score = 28.9 bits (63), Expect = 3.4 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -1 Query: 261 EFWDAPLKLASRN*DTESSGANRMAYTSPG*Q 166 +F P + T+SSG+ RM+YTSPG Q Sbjct: 2339 KFSQLPRTTSPSTASTKSSGSGRMSYTSPGRQ 2370
>SCRL3_ARATH (P82622) Hypothetical protein SCRL3 precursor| Length = 87 Score = 27.3 bits (59), Expect = 9.8 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +3 Query: 231 TPASKVHPRIPRVRICSCSR 290 T A+++ P +P R+C+CSR Sbjct: 66 TDATQISPSLPPQRVCNCSR 85 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,106,730 Number of Sequences: 219361 Number of extensions: 879418 Number of successful extensions: 1926 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1898 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1926 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)