| Clone Name | rbaet75c12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UBE12_WHEAT (P31251) Ubiquitin-activating enzyme E1 2 | 32 | 0.57 | 2 | UBE11_WHEAT (P20973) Ubiquitin-activating enzyme E1 1 | 32 | 0.57 | 3 | UBE13_WHEAT (P31252) Ubiquitin-activating enzyme E1 3 | 30 | 1.7 | 4 | RFCS_PYRAB (Q9V2G4) Replication factor C small subunit (RFC smal... | 28 | 8.3 |
|---|
>UBE12_WHEAT (P31251) Ubiquitin-activating enzyme E1 2| Length = 1051 Score = 31.6 bits (70), Expect = 0.57 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 239 PSYRRHLXXXXXXXXXXXXXXDIPLVSVYFR 147 PSYRRHL DIPLVSVYFR Sbjct: 1021 PSYRRHLDVVVACEDDDDNDVDIPLVSVYFR 1051
>UBE11_WHEAT (P20973) Ubiquitin-activating enzyme E1 1| Length = 1051 Score = 31.6 bits (70), Expect = 0.57 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 239 PSYRRHLXXXXXXXXXXXXXXDIPLVSVYFR 147 PSYRRHL DIPLVSVYFR Sbjct: 1021 PSYRRHLDVVVACEDDDDNDVDIPLVSVYFR 1051
>UBE13_WHEAT (P31252) Ubiquitin-activating enzyme E1 3| Length = 1053 Score = 30.0 bits (66), Expect = 1.7 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -3 Query: 239 PSYRRHLXXXXXXXXXXXXXXDIPLVSVYFR 147 P YRRHL DIPLVSVYFR Sbjct: 1023 PEYRRHLDIGVACEDEDENDVDIPLVSVYFR 1053
>RFCS_PYRAB (Q9V2G4) Replication factor C small subunit (RFC small subunit)| (Clamp loader small subunit) (PabRFC small subunit) [Contains: Pab RFC-1 intein; Pab RFC-2 intein] Length = 1437 Score = 27.7 bits (60), Expect = 8.3 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +1 Query: 25 FKPQLSLQYNNNYYCIKELKHYLRSGKMGH 114 ++PQ + + +K LKHY+++G M H Sbjct: 21 YRPQKLEEIVGQEHIVKRLKHYVKTGSMPH 50 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,181,604 Number of Sequences: 219361 Number of extensions: 433233 Number of successful extensions: 1121 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1121 length of database: 80,573,946 effective HSP length: 55 effective length of database: 68,509,091 effective search space used: 1644218184 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)