| Clone Name | rbaet75b12 |
|---|---|
| Clone Library Name | barley_pub |
>RL10_TOBAC (Q40592) 60S ribosomal protein L10 (QM protein homolog) (Fragment)| Length = 150 Score = 64.7 bits (156), Expect = 6e-11 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -3 Query: 294 YLKFKSEGRVLPDGVNAKLLGCHGRLANRAPGQAF 190 YLK+KSE R++PDGVNAKLLGCHGRLA R PG+AF Sbjct: 110 YLKYKSENRIVPDGVNAKLLGCHGRLAARQPGRAF 144
>RL102_ORYSA (P45636) 60S ribosomal protein L10-2 (Putative tumor suppressor| SG12) Length = 218 Score = 64.7 bits (156), Expect = 6e-11 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = -3 Query: 294 YLKFKSEGRVLPDGVNAKLLGCHGRLANRAPGQAF 190 Y++ KSEGR++PDGVNAKLLGCHGRL+ RAPG+AF Sbjct: 180 YVRLKSEGRIMPDGVNAKLLGCHGRLSARAPGKAF 214
>RL103_ORYSA (Q40649) 60S ribosomal protein L10-3 (QM/R22)| Length = 219 Score = 64.7 bits (156), Expect = 6e-11 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = -3 Query: 294 YLKFKSEGRVLPDGVNAKLLGCHGRLANRAPGQAF 190 Y++ KSEGR++PDGVNAKLLGCHGRL+ RAPG+AF Sbjct: 181 YVRLKSEGRIMPDGVNAKLLGCHGRLSARAPGKAF 215
>RL10_EUPES (Q9M5M7) 60S ribosomal protein L10| Length = 220 Score = 63.9 bits (154), Expect = 1e-10 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -3 Query: 294 YLKFKSEGRVLPDGVNAKLLGCHGRLANRAPGQAF 190 Y + KSE R+LPDGVNAKLLGCHGRLANR PG+AF Sbjct: 181 YPRLKSENRILPDGVNAKLLGCHGRLANRKPGRAF 215
>RL10_VITRI (Q9SPB3) 60S ribosomal protein L10 (QM protein homolog)| Length = 220 Score = 63.5 bits (153), Expect = 1e-10 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -3 Query: 294 YLKFKSEGRVLPDGVNAKLLGCHGRLANRAPGQAF 190 Y+K+KS+ R+LPDGVNAKLLGCHG LANR PG+AF Sbjct: 181 YIKWKSQNRILPDGVNAKLLGCHGPLANRQPGKAF 215
>RL10_MAIZE (P45633) 60S ribosomal protein L10 (QM protein homolog)| Length = 220 Score = 60.8 bits (146), Expect = 8e-10 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -3 Query: 294 YLKFKSEGRVLPDGVNAKLLGCHGRLANRAPGQAF 190 YLK+KSEGR++PDGVNAKLL HGRL RAPG+AF Sbjct: 181 YLKYKSEGRIVPDGVNAKLLANHGRLEKRAPGKAF 215
>RL10_PINTA (O22431) 60S ribosomal protein L10 (Wilm's tumor suppressor| homolog) Length = 228 Score = 58.5 bits (140), Expect = 4e-09 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -3 Query: 294 YLKFKSEGRVLPDGVNAKLLGCHGRLANRAPGQAF 190 YLK+K+E R++PDGVN KLLGC G L+NR PGQAF Sbjct: 181 YLKWKTENRIVPDGVNPKLLGCRGPLSNRKPGQAF 215
>RL101_ORYSA (P45635) 60S ribosomal protein L10-1 (Putative tumor suppressor| SC34) Length = 224 Score = 58.2 bits (139), Expect = 5e-09 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 291 LKFKSEGRVLPDGVNAKLLGCHGRLANRAPGQAF 190 LK K+EGR++ DGVNAKLLG HGRLA RAPG+AF Sbjct: 182 LKLKAEGRIMSDGVNAKLLGSHGRLAKRAPGKAF 215
>RL10_SOLME (P93847) 60S ribosomal protein L10 (EQM)| Length = 219 Score = 57.4 bits (137), Expect = 9e-09 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -3 Query: 294 YLKFKSEGRVLPDGVNAKLLGCHGRLANRAPGQAF 190 YLK+KSE R++PDGVNAKLLG HG LA R PG+AF Sbjct: 181 YLKYKSENRIVPDGVNAKLLGNHGPLAARQPGRAF 215
>RL10_ARATH (Q08770) 60S ribosomal protein L10 (Wilm tumor suppressor protein| homolog) Length = 221 Score = 54.3 bits (129), Expect = 8e-08 Identities = 23/35 (65%), Positives = 26/35 (74%) Frame = -3 Query: 294 YLKFKSEGRVLPDGVNAKLLGCHGRLANRAPGQAF 190 Y K + E R++PDGVNAK L CHG LANR PG AF Sbjct: 181 YTKLRQEKRIVPDGVNAKFLSCHGPLANRQPGSAF 215
>PHLC_MYCTU (P95245) Phospholipase C 3 precursor (EC 3.1.4.3)| Length = 517 Score = 30.0 bits (66), Expect = 1.6 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 179 AADRKACPGARFARRPWHPSSLALTPSGKTLPSLLN 286 A D P F ++ W+P + AL P+G TLP +N Sbjct: 74 AVDGFDTPTPLFQQKGWNPETQALDPTGITLPYRIN 109
>RPOA_EAVBU (P19811) Replicase polyprotein 1ab (ORF1ab polyprotein) [Includes:| Replicase polyprotein 1a (ORF1a)] [Contains: Nsp1 papain-like cysteine proteinase (EC 3.4.22.-) (PCP); Nsp2 cysteine proteinase (EC 3.4.22.-) (CP2) (CP); Nonstructural protein Length = 3175 Score = 29.6 bits (65), Expect = 2.0 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = +2 Query: 125 VADGKIRIDRTDSLLLDYAADRKACPGARFARRPWHPSSLALTPSGKTL 271 V D ++ I+ + A K PGARFA P + ++ ++P+ +L Sbjct: 104 VVDARLAIEEASVFISTDHASAKRFPGARFALTPVYANAWVVSPAANSL 152
>RL10_EUGGR (Q39724) 60S ribosomal protein L10| Length = 215 Score = 29.6 bits (65), Expect = 2.0 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -3 Query: 294 YLKFKSEGRVLPDGVNAKLLGCHGRL 217 Y+K+K EG+ DGV+ K+L GRL Sbjct: 181 YVKWKEEGKFRVDGVSTKILRNRGRL 206
>Y788_STRMU (Q8DUV4) Hypothetical RNA methyltransferase SMU.788 (EC 2.1.1.-)| Length = 451 Score = 28.9 bits (63), Expect = 3.5 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -1 Query: 260 LMESMLSCSDAMAALRTVPLDKLSCLPHNLAEDYQFYQSLFYRL 129 L ES + S AM + + +SC P +A D + Y+ L Y+L Sbjct: 387 LTESFIEASTAMQPRK---ITYISCAPATMARDVKLYEELGYKL 427
>SHAN1_RAT (Q9WV48) SH3 and multiple ankyrin repeat domains protein 1 (Shank1)| (GKAP/SAPAP-interacting protein) (SPANK-1) (Synamon) (Somatostatin receptor-interacting protein) (SSTR-interacting protein) (SSTRIP) Length = 2167 Score = 27.7 bits (60), Expect = 7.8 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = +2 Query: 179 AADRKACPGARFARRPWHPSSLALTPSGKTLPSLLNLR 292 A+D K P R PSSL + PSG P L ++R Sbjct: 2012 ASDHKVSPAPR-------PSSLPILPSGPIYPGLFDIR 2042
>HMEN_DROVI (P09145) Segmentation polarity homeobox protein engrailed| Length = 584 Score = 27.7 bits (60), Expect = 7.8 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -1 Query: 296 TTSSSRVRAGSCLMESMLSCSDAMAALRTVPLDKLS 189 T SSS A SC S CS A ++L + P +L+ Sbjct: 373 TISSSSSTAASCSASSSSGCSSAASSLNSSPSSRLA 408
>SYC_THEMA (Q9WZH8) Cysteinyl-tRNA synthetase (EC 6.1.1.16) (Cysteine--tRNA| ligase) (CysRS) Length = 460 Score = 27.7 bits (60), Expect = 7.8 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +2 Query: 125 VADGKIRIDRTDSLLLDYAADRKACPGARFARRPW 229 +A ++ +D T LD++ +KA PG + PW Sbjct: 162 IAGARVEVDETKKSPLDFSLWKKAKPGEPCWKSPW 196
>NOTC1_BRARE (P46530) Neurogenic locus notch homolog protein 1 precursor| Length = 2437 Score = 27.7 bits (60), Expect = 7.8 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = -2 Query: 166 KTISSINPYFTVCNLDSKRLWCYVILSECCVEPCY 62 K I IN Y VC C + + +C + PC+ Sbjct: 652 KCIDKINGYECVCEPGYSGSMCNINIDDCALNPCH 686 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,784,326 Number of Sequences: 219361 Number of extensions: 708919 Number of successful extensions: 2203 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 2107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2203 length of database: 80,573,946 effective HSP length: 74 effective length of database: 64,341,232 effective search space used: 1544189568 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)