| Clone Name | rbaet75b11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | JAD1D_PANTR (Q5XUN4) Jumonji/ARID domain-containing protein 1D (... | 30 | 2.1 | 2 | DBP9_SCHPO (O60080) ATP-dependent RNA helicase dbp9 (EC 3.6.1.-) | 29 | 2.8 | 3 | CBIO3_METMA (Q8PZN0) Putative cobalt import ATP-binding protein ... | 28 | 4.7 |
|---|
>JAD1D_PANTR (Q5XUN4) Jumonji/ARID domain-containing protein 1D (SmcY protein)| Length = 1535 Score = 29.6 bits (65), Expect = 2.1 Identities = 20/61 (32%), Positives = 31/61 (50%) Frame = -2 Query: 258 DVLNQVQQFQDYVREWSDFSFLVSCLEFRIGSQPGNQLSFVERKKKMGKDRPTSLVLRRQ 79 DVL QV+ +QD RE + S PG S +ER +++G + P + L++Q Sbjct: 862 DVLEQVEAYQDEARE----------ALATLPSSPGLLRSLLERGQQLGVEVPEAHQLQQQ 911 Query: 78 V 76 V Sbjct: 912 V 912
>DBP9_SCHPO (O60080) ATP-dependent RNA helicase dbp9 (EC 3.6.1.-)| Length = 595 Score = 29.3 bits (64), Expect = 2.8 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -2 Query: 162 QPGNQLSFVERKKKMGKDRPTSL 94 +PG +SFV K ++GK +PTSL Sbjct: 422 KPGTAMSFVVPKSEVGKHKPTSL 444
>CBIO3_METMA (Q8PZN0) Putative cobalt import ATP-binding protein cbiO 3| Length = 453 Score = 28.5 bits (62), Expect = 4.7 Identities = 19/71 (26%), Positives = 30/71 (42%), Gaps = 10/71 (14%) Frame = -2 Query: 258 DVLNQVQQFQ----------DYVREWSDFSFLVSCLEFRIGSQPGNQLSFVERKKKMGKD 109 D+LN+ F D WSD+ FL+S + P E KK+G Sbjct: 180 DLLNEFNHFGSTIIISTHDVDLAYRWSDYVFLMSNSKLIGQGTPAEVFKEQELLKKVGLR 239 Query: 108 RPTSLVLRRQV 76 +PT+L + ++ Sbjct: 240 QPTTLEIYHEI 250 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,547,297 Number of Sequences: 219361 Number of extensions: 735085 Number of successful extensions: 2065 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2044 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2065 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)