| Clone Name | rbaet75b02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RNH2_ZYMMO (Q5NNT2) Ribonuclease HII (EC 3.1.26.4) (RNase HII) | 28 | 7.4 |
|---|
>RNH2_ZYMMO (Q5NNT2) Ribonuclease HII (EC 3.1.26.4) (RNase HII)| Length = 215 Score = 27.7 bits (60), Expect = 7.4 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +3 Query: 3 VTRASLLKEKRKTTALLEHLGILPEAHA*KGRDSVHW 113 + +ASLL KR AL++ +G P+ GRD W Sbjct: 96 IRQASLLAMKRAVEALIQKIGREPDCILVDGRDIPDW 132 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,978,495 Number of Sequences: 219361 Number of extensions: 434268 Number of successful extensions: 964 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 938 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 964 length of database: 80,573,946 effective HSP length: 87 effective length of database: 61,489,539 effective search space used: 1475748936 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)