| Clone Name | rbaet74g11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RBM7_BOVIN (Q3MHY8) RNA-binding protein 7 (RNA-binding motif pro... | 32 | 0.46 | 2 | CG23_YEAST (P24870) G2/mitotic-specific cyclin-3 | 29 | 3.9 | 3 | TSH_DROME (P22265) Protein teashirt | 28 | 8.7 |
|---|
>RBM7_BOVIN (Q3MHY8) RNA-binding protein 7 (RNA-binding motif protein 7)| Length = 262 Score = 32.0 bits (71), Expect = 0.46 Identities = 19/49 (38%), Positives = 25/49 (51%) Frame = +3 Query: 30 SQQNTRLMNSRAYTTDRHIQRYPQYSHRRHHHASRIYRTNKECTEHRDQ 176 SQ+ RL NS Y DRH R +YS HH YR N++ + D+ Sbjct: 193 SQRKVRL-NSHPYVMDRHYSREQRYSDLSDHH----YRGNRDDFFYEDR 236
>CG23_YEAST (P24870) G2/mitotic-specific cyclin-3| Length = 427 Score = 28.9 bits (63), Expect = 3.9 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 5/57 (8%) Frame = +3 Query: 15 YYTLLSQQN-----TRLMNSRAYTTDRHIQRYPQYSHRRHHHASRIYRTNKECTEHR 170 YY+ +Q+ T ++ + Y + RH + +YS RR+ H+S+I EHR Sbjct: 366 YYSNYTQEQILPLATIILENCRYASKRHNAIWRKYSSRRYLHSSQIVAKWIALAEHR 422
>TSH_DROME (P22265) Protein teashirt| Length = 954 Score = 27.7 bits (60), Expect = 8.7 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +1 Query: 64 PTQPTDIYNGTLNIHTDGTTTHHVSTGRTKNAQSTATRPP 183 PT P N L H+ G+ ++H + KNA PP Sbjct: 401 PTPPPPPQNHNLRKHSSGSASNHSPSANVKNAFQYRGDPP 440 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,517,585 Number of Sequences: 219361 Number of extensions: 517036 Number of successful extensions: 1874 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1814 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1868 length of database: 80,573,946 effective HSP length: 37 effective length of database: 72,457,589 effective search space used: 1738982136 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)