ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaet74g06 |
|---|---|
| Clone Library Name | barley_pub |
>CYPH_LYCES (P21568) Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) (PPIase)| (Rotamase) (Cyclophilin) (Cyclosporin A-binding protein) Length = 171 Score = 51.2 bits (121), Expect = 6e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -3 Query: 349 VEGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 VEGMDV+K E VGS SG CSK VVIADCGQ Sbjct: 140 VEGMDVIKKAEAVGSSSGRCSKPVVIADCGQ 170
>CYPH_MAIZE (P21569) Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) (PPIase)| (Rotamase) (Cyclophilin) (Cyclosporin A-binding protein) Length = 172 Score = 47.8 bits (112), Expect = 7e-06 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -3 Query: 349 VEGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 VEGMDVVK +EKVG+R+G SK V +ADCGQ Sbjct: 140 VEGMDVVKAIEKVGTRNGSTSKVVKVADCGQ 170
>CYPH_CATRO (Q39613) Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) (PPIase)| (Rotamase) (Cyclophilin) (Cyclosporin A-binding protein) Length = 172 Score = 47.8 bits (112), Expect = 7e-06 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -3 Query: 349 VEGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 VEGMDVVK +EKVGS SG +K+VV+ DCGQ Sbjct: 140 VEGMDVVKAIEKVGSSSGRTAKKVVVEDCGQ 170
>CYPH_BRANA (P24525) Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) (PPIase)| (Rotamase) (Cyclophilin) (Cyclosporin A-binding protein) Length = 171 Score = 47.4 bits (111), Expect = 9e-06 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -3 Query: 349 VEGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 VEGMDVV+++EKVGS SG SK+VV DCGQ Sbjct: 140 VEGMDVVRDIEKVGSDSGRTSKKVVTCDCGQ 170
>CP18C_ARATH (P34790) Peptidyl-prolyl cis-trans isomerase CYP18-3 (EC 5.2.1.8)| (PPIase CYP18-3) (Rotamase cyclophilin-1) (Cyclophilin of 18 kDa 3) (Cyclosporin A-binding protein) Length = 172 Score = 47.0 bits (110), Expect = 1e-05 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -3 Query: 349 VEGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 VEG+DVVK +EKVGS SG +K VV+ADCGQ Sbjct: 140 VEGLDVVKAIEKVGSSSGKPTKPVVVADCGQ 170
>CP19A_ARATH (Q38900) Peptidyl-prolyl cis-trans isomerase CYP19-1 (EC 5.2.1.8)| (PPIase CYP19-1) (Rotamase cyclophilin-3) (Cyclophilin of 19 kDa 1) Length = 173 Score = 47.0 bits (110), Expect = 1e-05 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -3 Query: 349 VEGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 VEG++VV+++EKVGS SG SK VVIADCGQ Sbjct: 141 VEGLNVVRDIEKVGSDSGRTSKPVVIADCGQ 171
>CYPH_ALLCE (P34887) Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) (PPIase)| (Rotamase) (Cyclophilin) (Cyclosporin A-binding protein) Length = 150 Score = 46.2 bits (108), Expect = 2e-05 Identities = 22/31 (70%), Positives = 25/31 (80%) Frame = -3 Query: 349 VEGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 VEGMDVV+ +EKVGS+SG K V IADCGQ Sbjct: 118 VEGMDVVRAIEKVGSQSGQTKKPVKIADCGQ 148
>PPIF_HUMAN (P30405) Peptidyl-prolyl cis-trans isomerase, mitochondrial| precursor (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin F) Length = 207 Score = 45.8 bits (107), Expect = 3e-05 Identities = 20/30 (66%), Positives = 24/30 (80%) Frame = -3 Query: 346 EGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 EGMDVVK +E GS+SG SK++VI DCGQ Sbjct: 176 EGMDVVKKIESFGSKSGRTSKKIVITDCGQ 205
>CP19B_ARATH (Q9SKQ0) Peptidyl-prolyl cis-trans isomerase CYP19-2 (EC 5.2.1.8)| (PPIase CYP19-2) (Rotamase cyclophilin-6) (Cyclophilin of 19 kDa 2) (Cyclophilin-2) Length = 174 Score = 45.8 bits (107), Expect = 3e-05 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = -3 Query: 349 VEGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 VEG+DVVK +EK+GS SG +K VVIADCG+ Sbjct: 141 VEGLDVVKAIEKIGSSSGKPTKPVVIADCGE 171
>PPIF_RAT (P29117) Peptidyl-prolyl cis-trans isomerase, mitochondrial| precursor (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin F) Length = 206 Score = 45.8 bits (107), Expect = 3e-05 Identities = 20/30 (66%), Positives = 24/30 (80%) Frame = -3 Query: 346 EGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 EGMDVVK +E GS+SG SK++VI DCGQ Sbjct: 175 EGMDVVKKIESFGSKSGKTSKKIVITDCGQ 204
>PPIF_MOUSE (Q99KR7) Peptidyl-prolyl cis-trans isomerase, mitochondrial| precursor (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin F) Length = 206 Score = 45.8 bits (107), Expect = 3e-05 Identities = 20/30 (66%), Positives = 24/30 (80%) Frame = -3 Query: 346 EGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 EGMDVVK +E GS+SG SK++VI DCGQ Sbjct: 175 EGMDVVKKIESFGSKSGKTSKKIVITDCGQ 204
>CYPH_LUPLU (O49886) Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) (PPIase)| (Rotamase) (Cyclophilin) (Cyclosporin A-binding protein) Length = 172 Score = 45.1 bits (105), Expect = 4e-05 Identities = 20/31 (64%), Positives = 26/31 (83%) Frame = -3 Query: 349 VEGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 +EGM+VV+++EKVGS SG S+ V IADCGQ Sbjct: 140 IEGMNVVRDIEKVGSGSGKTSRPVTIADCGQ 170
>CP18D_ARATH (Q42406) Peptidyl-prolyl cis-trans isomerase CYP18-4 (EC 5.2.1.8)| (PPIase CYP18-4) (Rotamase cyclophilin-5) (Cyclophilin of 18 kDa 4) (Cyclophilin-1) Length = 172 Score = 43.9 bits (102), Expect = 1e-04 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -3 Query: 349 VEGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 V+G+DVVK +EKVGS SG SK V I DCGQ Sbjct: 140 VKGLDVVKAIEKVGSDSGKTSKVVTITDCGQ 170
>PPIA_BLAGE (P54985) Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) (PPIase)| (Rotamase) (Cyclophilin) (Cyclosporin A-binding protein) Length = 164 Score = 43.9 bits (102), Expect = 1e-04 Identities = 18/31 (58%), Positives = 25/31 (80%) Frame = -3 Query: 349 VEGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 VEGMDVVK +E +GS+SG +K++ + DCGQ Sbjct: 133 VEGMDVVKKLESLGSQSGKTNKKIAVVDCGQ 163
>CYP1_CAEEL (P52009) Peptidyl-prolyl cis-trans isomerase 1 (EC 5.2.1.8)| (PPIase) (Rotamase) (Cyclophilin-1) Length = 192 Score = 43.5 bits (101), Expect = 1e-04 Identities = 19/30 (63%), Positives = 24/30 (80%) Frame = -3 Query: 346 EGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 +GM VVK +EK+GSRSG +K V IADCG+ Sbjct: 159 DGMSVVKKIEKMGSRSGAPAKTVTIADCGE 188
>PPIA_HEMPU (P91791) Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) (PPIase)| (Rotamase) (Cyclophilin) (Cyclosporin A-binding protein) Length = 164 Score = 41.6 bits (96), Expect = 5e-04 Identities = 17/30 (56%), Positives = 23/30 (76%) Frame = -3 Query: 346 EGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 +G+D++K VE GS SG SK++ IADCGQ Sbjct: 134 QGLDIIKKVESYGSDSGKTSKKITIADCGQ 163
>PPIA_PIG (P62936) Peptidyl-prolyl cis-trans isomerase A (EC 5.2.1.8) (PPIase| A) (Rotamase A) (Cyclophilin A) (Cyclosporin A-binding protein) Length = 163 Score = 41.2 bits (95), Expect = 6e-04 Identities = 17/30 (56%), Positives = 25/30 (83%) Frame = -3 Query: 346 EGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 EGM++V+ +E+ GSR+G SK++ IADCGQ Sbjct: 133 EGMNIVEAMERFGSRNGKTSKKITIADCGQ 162
>PPIA_FELCA (Q8HXS3) Peptidyl-prolyl cis-trans isomerase A (EC 5.2.1.8) (PPIase| A) (Rotamase A) (Cyclophilin A) (Cyclosporin A-binding protein) Length = 163 Score = 41.2 bits (95), Expect = 6e-04 Identities = 17/30 (56%), Positives = 25/30 (83%) Frame = -3 Query: 346 EGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 EGM++V+ +E+ GSR+G SK++ IADCGQ Sbjct: 133 EGMNIVEAMERFGSRNGKTSKKITIADCGQ 162
>PPIA_BOVIN (P62935) Peptidyl-prolyl cis-trans isomerase A (EC 5.2.1.8) (PPIase| A) (Rotamase A) (Cyclophilin A) (Cyclosporin A-binding protein) Length = 163 Score = 41.2 bits (95), Expect = 6e-04 Identities = 17/30 (56%), Positives = 25/30 (83%) Frame = -3 Query: 346 EGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 EGM++V+ +E+ GSR+G SK++ IADCGQ Sbjct: 133 EGMNIVEAMERFGSRNGKTSKKITIADCGQ 162
>PPIA_AOTTR (Q6DTV9) Peptidyl-prolyl cis-trans isomerase A (EC 5.2.1.8) (PPIase| A) (Rotamase A) (Cyclophilin A) (Cyclosporin A-binding protein) Length = 163 Score = 41.2 bits (95), Expect = 6e-04 Identities = 17/30 (56%), Positives = 25/30 (83%) Frame = -3 Query: 346 EGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 EGM++V+ +E+ GSR+G SK++ IADCGQ Sbjct: 133 EGMNIVEAMERFGSRNGKTSKKITIADCGQ 162
>PPIA_PONPY (Q5R8S7) Peptidyl-prolyl cis-trans isomerase A (EC 5.2.1.8) (PPIase| A) (Rotamase A) (Cyclophilin A) (Cyclosporin A-binding protein) Length = 164 Score = 41.2 bits (95), Expect = 6e-04 Identities = 17/30 (56%), Positives = 25/30 (83%) Frame = -3 Query: 346 EGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 EGM++V+ +E+ GSR+G SK++ IADCGQ Sbjct: 133 EGMNIVEAMERFGSRNGKTSKKITIADCGQ 162
>PPIA_PAPAN (P62941) Peptidyl-prolyl cis-trans isomerase A (EC 5.2.1.8) (PPIase| A) (Rotamase A) (Cyclophilin A) (Cyclosporin A-binding protein) Length = 164 Score = 41.2 bits (95), Expect = 6e-04 Identities = 17/30 (56%), Positives = 25/30 (83%) Frame = -3 Query: 346 EGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 EGM++V+ +E+ GSR+G SK++ IADCGQ Sbjct: 133 EGMNIVEAMERFGSRNGKTSKKITIADCGQ 162
>PPIA_MACMU (P62940) Peptidyl-prolyl cis-trans isomerase A (EC 5.2.1.8) (PPIase| A) (Rotamase A) (Cyclophilin A) (Cyclosporin A-binding protein) Length = 164 Score = 41.2 bits (95), Expect = 6e-04 Identities = 17/30 (56%), Positives = 25/30 (83%) Frame = -3 Query: 346 EGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 EGM++V+ +E+ GSR+G SK++ IADCGQ Sbjct: 133 EGMNIVEAMERFGSRNGKTSKKITIADCGQ 162
>PPIA_HUMAN (P62937) Peptidyl-prolyl cis-trans isomerase A (EC 5.2.1.8) (PPIase| A) (Rotamase A) (Cyclophilin A) (Cyclosporin A-binding protein) Length = 164 Score = 41.2 bits (95), Expect = 6e-04 Identities = 17/30 (56%), Positives = 25/30 (83%) Frame = -3 Query: 346 EGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 EGM++V+ +E+ GSR+G SK++ IADCGQ Sbjct: 133 EGMNIVEAMERFGSRNGKTSKKITIADCGQ 162
>PPIA_CERAE (P62938) Peptidyl-prolyl cis-trans isomerase A (EC 5.2.1.8) (PPIase| A) (Rotamase A) (Cyclophilin A) (Cyclosporin A-binding protein) Length = 164 Score = 41.2 bits (95), Expect = 6e-04 Identities = 17/30 (56%), Positives = 25/30 (83%) Frame = -3 Query: 346 EGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 EGM++V+ +E+ GSR+G SK++ IADCGQ Sbjct: 133 EGMNIVEAMERFGSRNGKTSKKITIADCGQ 162
>PPIA_MOUSE (P17742) Peptidyl-prolyl cis-trans isomerase A (EC 5.2.1.8) (PPIase| A) (Rotamase A) (Cyclophilin A) (Cyclosporin A-binding protein) (SP18) Length = 163 Score = 40.0 bits (92), Expect = 0.001 Identities = 16/30 (53%), Positives = 25/30 (83%) Frame = -3 Query: 346 EGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 EGM++V+ +E+ GSR+G SK++ I+DCGQ Sbjct: 133 EGMNIVEAMERFGSRNGKTSKKITISDCGQ 162
>PPIA_CRIGR (P14851) Peptidyl-prolyl cis-trans isomerase A (EC 5.2.1.8) (PPIase| A) (Rotamase A) (Cyclophilin A) (Cyclosporin A-binding protein) Length = 163 Score = 40.0 bits (92), Expect = 0.001 Identities = 16/30 (53%), Positives = 25/30 (83%) Frame = -3 Query: 346 EGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 EGM++V+ +E+ GSR+G SK++ I+DCGQ Sbjct: 133 EGMNIVEAMERFGSRNGKTSKKITISDCGQ 162
>PPIA_SCHMA (Q26565) Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) (PPIase)| (Rotamase) (Cyclophilin) (Cyclosporin A-binding protein) (p17.7) (Smp17.7) Length = 161 Score = 40.0 bits (92), Expect = 0.001 Identities = 17/31 (54%), Positives = 24/31 (77%) Frame = -3 Query: 349 VEGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 V G+DVVK +E +GS SG SK+++I DCG+ Sbjct: 130 VSGIDVVKKMESLGSTSGKPSKKIIIEDCGE 160
>CYP3_CAEEL (P52011) Peptidyl-prolyl cis-trans isomerase 3 (EC 5.2.1.8)| (PPIase) (Rotamase) (Cyclophilin-3) Length = 173 Score = 40.0 bits (92), Expect = 0.001 Identities = 20/31 (64%), Positives = 23/31 (74%) Frame = -3 Query: 349 VEGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 VEG+DVVK VE GS+SG K +IADCGQ Sbjct: 140 VEGLDVVKAVESNGSQSGKPVKDCMIADCGQ 170
>PPIA_RAT (P10111) Peptidyl-prolyl cis-trans isomerase A (EC 5.2.1.8) (PPIase| A) (Rotamase A) (Cyclophilin A) (Cyclosporin A-binding protein) (p31) (p1B15) Length = 163 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/30 (53%), Positives = 24/30 (80%) Frame = -3 Query: 346 EGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 EGM +V+ +E+ GSR+G SK++ I+DCGQ Sbjct: 133 EGMSIVEAMERFGSRNGKTSKKITISDCGQ 162
>PPIA_ECHGR (P14088) Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) (PPIase)| (Rotamase) (Cyclophilin) (Cyclosporin A-binding protein) (EGCyP-1) Length = 162 Score = 39.3 bits (90), Expect = 0.002 Identities = 18/29 (62%), Positives = 23/29 (79%) Frame = -3 Query: 343 GMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 G DVVK++E VGS SG S++V+I DCGQ Sbjct: 133 GEDVVKDMEAVGSSSGKTSQEVLITDCGQ 161
>CYP2_CAEEL (P52010) Peptidyl-prolyl cis-trans isomerase 2 (EC 5.2.1.8)| (PPIase) (Rotamase) (Cyclophilin-2) Length = 172 Score = 39.3 bits (90), Expect = 0.002 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = -3 Query: 349 VEGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 +EGMDVVK +E GS G S VIADCG+ Sbjct: 140 IEGMDVVKAIESKGSEDGAPSAPCVIADCGE 170
>PPIA_DROME (P25007) Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) (PPIase)| (Rotamase) (Cyclophilin) (Cyclosporin A-binding protein) Length = 227 Score = 38.9 bits (89), Expect = 0.003 Identities = 16/30 (53%), Positives = 24/30 (80%) Frame = -3 Query: 349 VEGMDVVKNVEKVGSRSGICSKQVVIADCG 260 VEG+DVVK +E GS+SG SK++++A+ G Sbjct: 196 VEGLDVVKKIESYGSQSGKTSKKIIVANSG 225
>CYPH_SCHPO (P18253) Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) (PPIase)| (Rotamase) (Cyclophilin) (Cyclosporin A-binding protein) (CPH) Length = 162 Score = 37.4 bits (85), Expect = 0.009 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = -3 Query: 346 EGMDVVKNVEKVGSRSGICSKQVVIADCG 260 EGMDVVK VE +GS SG ++VI CG Sbjct: 132 EGMDVVKKVESLGSNSGATRARIVIDKCG 160
>CYP7_CAEEL (P52015) Peptidyl-prolyl cis-trans isomerase 7 (EC 5.2.1.8)| (PPIase) (Rotamase) (Cyclophilin-7) Length = 171 Score = 37.4 bits (85), Expect = 0.009 Identities = 17/31 (54%), Positives = 21/31 (67%) Frame = -3 Query: 349 VEGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 VEG+D+V VE GS SG + +IADCGQ Sbjct: 140 VEGLDIVSKVEGNGSSSGTPKSECLIADCGQ 170
>RBP2_BOVIN (P48820) Ran-binding protein 2 (RanBP2) (Nuclear pore complex protein| Nup358) (Nucleoporin Nup358) (358 kDa nucleoporin) (P270) (Fragment) Length = 1085 Score = 37.4 bits (85), Expect = 0.009 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = -3 Query: 346 EGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 +GMD VK +E GS G S++++I +CGQ Sbjct: 1055 DGMDTVKKIESFGSPKGSVSRRIIITECGQ 1084
>PPIA_CANAL (P22011) Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) (PPIase)| (Rotamase) (Cyclophilin) (Cyclosporin A-binding protein) (CPH) Length = 162 Score = 36.6 bits (83), Expect = 0.016 Identities = 15/30 (50%), Positives = 22/30 (73%) Frame = -3 Query: 346 EGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 +G+D+VK +E GS SG SK++VI + GQ Sbjct: 132 DGLDIVKKIESFGSGSGATSKKIVIEESGQ 161
>PPIE_HUMAN (Q9UNP9) Peptidyl-prolyl cis-trans isomerase E (EC 5.2.1.8) (PPIase| E) (Rotamase E) (Cyclophilin E) (Cyclophilin 33) Length = 301 Score = 36.6 bits (83), Expect = 0.016 Identities = 14/30 (46%), Positives = 23/30 (76%) Frame = -3 Query: 346 EGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 EG+DV++ +E GS+ G ++V+IADCG+ Sbjct: 270 EGLDVLRQIEAQGSKDGKPKQKVIIADCGE 299
>PPIE_SCHMA (Q26548) Peptidyl-prolyl cis-trans isomerase E (EC 5.2.1.8) (PPIase| E) (Rotamase E) (Cyclophilin E) Length = 273 Score = 35.8 bits (81), Expect = 0.027 Identities = 15/31 (48%), Positives = 23/31 (74%) Frame = -3 Query: 349 VEGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 V+G +VVK +E VGS+SG + V+I+ CG+ Sbjct: 241 VDGQNVVKKMESVGSKSGKVKEPVIISRCGE 271
>PPIA_RABIT (Q9TTC6) Peptidyl-prolyl cis-trans isomerase A (EC 5.2.1.8) (PPIase| A) (Rotamase A) (Cyclophilin A) (Cyclosporin A-binding protein) (Cyclophilin 18) Length = 163 Score = 35.8 bits (81), Expect = 0.027 Identities = 15/30 (50%), Positives = 22/30 (73%) Frame = -3 Query: 346 EGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 EGM +V+ +E GS +G SK++ IA+CGQ Sbjct: 133 EGMSIVEAMEHFGSENGKTSKKITIANCGQ 162
>PPIE_MOUSE (Q9QZH3) Peptidyl-prolyl cis-trans isomerase E (EC 5.2.1.8) (PPIase| E) (Rotamase E) (Cyclophilin E) (Cyclophilin 33) Length = 301 Score = 35.8 bits (81), Expect = 0.027 Identities = 14/30 (46%), Positives = 23/30 (76%) Frame = -3 Query: 346 EGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 EG+DV++ +E GS+ G ++V+IADCG+ Sbjct: 270 EGLDVLRQIEAQGSKDGKPKQKVMIADCGE 299
>CP19C_ARATH (Q38867) Peptidyl-prolyl cis-trans isomerase CYP19-3 (EC 5.2.1.8)| (PPIase CYP19-3) (Rotamase cyclophilin-2) (Cyclophilin of 19 kDa 3) (Cyclophilin-4) Length = 176 Score = 35.0 bits (79), Expect = 0.046 Identities = 17/31 (54%), Positives = 23/31 (74%) Frame = -3 Query: 349 VEGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 V+G +VVK +E VGS G S++VVI DCG+ Sbjct: 140 VDGYNVVKAMEDVGSDMGNPSERVVIEDCGE 170
>PPIE_SCHJA (Q26516) Peptidyl-prolyl cis-trans isomerase E (EC 5.2.1.8) (PPIase| E) (Rotamase E) (Cyclophilin E) (Fragment) Length = 179 Score = 34.7 bits (78), Expect = 0.060 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = -3 Query: 349 VEGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 V+G +VVK +E VGS+SG + V I+ CG+ Sbjct: 147 VDGQNVVKKMESVGSKSGKVKEPVTISRCGE 177
>RBP2_MOUSE (Q9ERU9) Ran-binding protein 2 (RanBP2)| Length = 3053 Score = 34.7 bits (78), Expect = 0.060 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = -3 Query: 346 EGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 +GMD V+ +E GS G S+++ I +CGQ Sbjct: 3023 DGMDTVRKIESFGSPKGSVSRRICITECGQ 3052
>PPI2_SYNY3 (P73789) Peptidyl-prolyl cis-trans isomerase slr1251 (EC 5.2.1.8)| (PPIase) (Rotamase) Length = 171 Score = 34.7 bits (78), Expect = 0.060 Identities = 13/31 (41%), Positives = 24/31 (77%) Frame = -3 Query: 349 VEGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 VEG+++++ +E GS+SG + +VI+DCG+ Sbjct: 139 VEGLEILEQLEANGSQSGQTKQAIVISDCGE 169
>PPIE_DROME (Q9V3G3) Peptidyl-prolyl cis-trans isomerase E (EC 5.2.1.8) (PPIase| E) (Rotamase E) (Cyclophilin E) (Cyclophilin 33) Length = 300 Score = 34.3 bits (77), Expect = 0.078 Identities = 13/31 (41%), Positives = 23/31 (74%) Frame = -3 Query: 349 VEGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 + G +VV+ +E+ GS+SG S+++VI CG+ Sbjct: 268 ISGAEVVRKMERCGSKSGTPSQKIVIYSCGE 298
>RBP2_HUMAN (P49792) Ran-binding protein 2 (RanBP2) (Nuclear pore complex protein| Nup358) (Nucleoporin Nup358) (358 kDa nucleoporin) (P270) Length = 3224 Score = 34.3 bits (77), Expect = 0.078 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -3 Query: 346 EGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 +GMD VK +E GS G +++ I +CGQ Sbjct: 3194 DGMDTVKKIESFGSPKGSVCRRITITECGQ 3223
>CP19D_ARATH (Q8LDP4) Peptidyl-prolyl cis-trans isomerase CYP19-4 precursor (EC| 5.2.1.8) (PPIase CYP19-4) (Rotamase CYP19-4) (Cyclophilin of 19 kDa 4) (Cyclophilin-5) Length = 201 Score = 34.3 bits (77), Expect = 0.078 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = -3 Query: 349 VEGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 V+GMDVV +E G +SG +VVIAD G+ Sbjct: 168 VQGMDVVYKIEAEGKQSGTPKSKVVIADSGE 198
>CYPH_YEAST (P14832) Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) (PPIase)| (Rotamase) (Cyclophilin) (Cyclosporin A-binding protein) (CPH) (PPI-II) Length = 161 Score = 33.5 bits (75), Expect = 0.13 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = -3 Query: 349 VEGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 V+G D+VK VE +GS SG ++V+A G+ Sbjct: 130 VDGYDIVKKVESLGSPSGATKARIVVAKSGE 160
>CP20A_ARATH (Q9SP02) Peptidyl-prolyl cis-trans isomerase CYP20-1 precursor (EC| 5.2.1.8) (PPIase CYP20-1) (Rotamase cyclophilin-7) (Cyclophilin of 20 kDa 1) Length = 204 Score = 32.3 bits (72), Expect = 0.30 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = -3 Query: 349 VEGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 V GMDVV VE G++SG +VVI D G+ Sbjct: 171 VTGMDVVYKVEAEGNQSGTPKSKVVIVDSGE 201
>CYPH_UROFA (O00060) Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) (PPIase)| (Rotamase) (Cyclophilin) (Cyclosporin A-binding protein) (Planta-induced rust protein 28) Length = 163 Score = 32.0 bits (71), Expect = 0.39 Identities = 17/31 (54%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = -3 Query: 349 VEGMD-VVKNVEKVGSRSGICSKQVVIADCG 260 +EG D VVK +EK GS+SG S + I DCG Sbjct: 131 IEGYDQVVKAMEKTGSQSGKTSSVLKIEDCG 161
>CP20B_ARATH (Q9ASS6) Peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplast| precursor (EC 5.2.1.8) (PPIase CYP20-2) (Rotamase CYP20-2) (Cyclophilin of 20 kDa 2) (Thylakoid lumen PPIase of 20 kDa) (TLP20) Length = 259 Score = 31.6 bits (70), Expect = 0.50 Identities = 17/32 (53%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = -3 Query: 349 VEGMDVVKNVEKVGS-RSGICSKQVVIADCGQ 257 +EGM+VVK +E+ + R K+VVIADCGQ Sbjct: 222 IEGMEVVKLIEEQETDRGDRPRKKVVIADCGQ 253
>PPIF_BOVIN (P30404) Peptidyl-prolyl cis-trans isomerase, mitochondrial| precursor (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin F) Length = 209 Score = 31.6 bits (70), Expect = 0.50 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = -3 Query: 346 EGMDVVKNVEKVGSRSGICSKQ 281 EGMDVVK +E GS+SG SK+ Sbjct: 177 EGMDVVKKIESFGSKSGKTSKK 198
>CYPC_YEAST (P25719) Peptidyl-prolyl cis-trans isomerase C, mitochondrial| precursor (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin C) (PPI-III) Length = 182 Score = 29.6 bits (65), Expect = 1.9 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -3 Query: 346 EGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 +GMD+VK +E G+ SG ++VI + G+ Sbjct: 152 KGMDIVKAIESYGTASGKPRAEIVIEEAGE 181
>PPIB_CHICK (P24367) Peptidyl-prolyl cis-trans isomerase B precursor (EC| 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin B) (S-cyclophilin) (SCYLP) Length = 207 Score = 28.5 bits (62), Expect = 4.3 Identities = 18/32 (56%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = -3 Query: 349 VEGMDVVKNVE--KVGSRSGICSKQVVIADCG 260 +EGMDVV+ VE K SR K V IADCG Sbjct: 164 LEGMDVVRKVENTKTDSRDKPL-KDVTIADCG 194
>PPIH_NEUCR (Q7SG06) Peptidyl-prolyl cis-trans isomerase H (EC 5.2.1.8) (PPIase| H) (Rotamase H) Length = 182 Score = 28.5 bits (62), Expect = 4.3 Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 3/34 (8%) Frame = -3 Query: 349 VEGMDVVKNVE--KVGSR-SGICSKQVVIADCGQ 257 V+GMDVVK +E K G R + + VVIA CG+ Sbjct: 148 VDGMDVVKKMENTKTGYRGKDVPNLDVVIAQCGE 181
>PPIB_RAT (P24368) Peptidyl-prolyl cis-trans isomerase B precursor (EC| 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin B) (S-cyclophilin) (SCYLP) (CYP-S1) Length = 208 Score = 28.5 bits (62), Expect = 4.3 Identities = 17/33 (51%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = -3 Query: 349 VEGMDVVKNVE--KVGSRSGICSKQVVIADCGQ 257 +EGMDVV+ VE K SR K V+I DCG+ Sbjct: 165 LEGMDVVRKVENTKTDSRDKPL-KDVIIVDCGK 196
>PPIB_HUMAN (P23284) Peptidyl-prolyl cis-trans isomerase B precursor (EC| 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin B) (S-cyclophilin) (SCYLP) (CYP-S1) Length = 208 Score = 28.5 bits (62), Expect = 4.3 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 2/33 (6%) Frame = -3 Query: 349 VEGMDVVKNVE--KVGSRSGICSKQVVIADCGQ 257 +EGM+VV+ VE K SR K V+IADCG+ Sbjct: 165 LEGMEVVRKVESTKTDSRDKPL-KDVIIADCGK 196
>PPID_AMAMU (Q5U8Z7) Peptidyl-prolyl cis-trans isomerase D (EC 5.2.1.8) (PPIase| D) (Rotamase D) Length = 371 Score = 28.1 bits (61), Expect = 5.6 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = -3 Query: 349 VEGMDVVKNVEKVGSRSGICSKQ-VVIADCGQ 257 ++G VV+ +E + +G K+ VVIADCGQ Sbjct: 141 IKGRSVVRTIENNPATNGDVPKEPVVIADCGQ 172
>PPID_NEUCR (Q9P3X9) 41 kDa peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8)| (PPIase) (Rotamase) (Cyclophilin-41) (CYP-41) Length = 375 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -3 Query: 349 VEGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 + G VV+ +E + ++ +K VIADCG+ Sbjct: 148 LSGKSVVRQIENLKTQGDKPTKDAVIADCGE 178
>SYFA_MYCMS (Q6MT17) Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase alpha chain) (PheRS) Length = 350 Score = 27.3 bits (59), Expect = 9.5 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -2 Query: 146 PSDEISVVGLGGF*VDSLGCWICVRPPWLSSLVCYRLNE 30 PS E+ V F DS GC+IC + W+ L +NE Sbjct: 261 PSVEVDV---SCFKCDSKGCFICKKTGWIEILGAGMINE 296
>SYFA_MYCCT (Q2SSA0) Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase alpha chain) (PheRS) Length = 350 Score = 27.3 bits (59), Expect = 9.5 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -2 Query: 146 PSDEISVVGLGGF*VDSLGCWICVRPPWLSSLVCYRLNE 30 PS E+ V F DS GC+IC + W+ L +NE Sbjct: 261 PSVEVDV---SCFKCDSKGCFICKKTGWIEILGAGMINE 296
>PPIB_BOVIN (P80311) Peptidyl-prolyl cis-trans isomerase B precursor (EC| 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin B) (S-cyclophilin) (SCYLP) Length = 208 Score = 27.3 bits (59), Expect = 9.5 Identities = 17/33 (51%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 349 VEGMDVVKNVE--KVGSRSGICSKQVVIADCGQ 257 +EGMDVV+ VE K R K V IADCG+ Sbjct: 165 LEGMDVVRKVESTKTDGRDKPL-KDVTIADCGK 196
>PPIH_ASPFU (Q4WCM6) Peptidyl-prolyl cis-trans isomerase H (EC 5.2.1.8) (PPIase| H) (Rotamase H) Length = 181 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -3 Query: 349 VEGMDVVKNVEKVGSRSGICSKQVVIADCGQ 257 V+GMD+V+ +E + S+ V+I CG+ Sbjct: 150 VDGMDIVRMIENTRTIRDKPSQDVIITQCGE 180 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,425,431 Number of Sequences: 219361 Number of extensions: 356012 Number of successful extensions: 819 Number of sequences better than 10.0: 64 Number of HSP's better than 10.0 without gapping: 812 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 818 length of database: 80,573,946 effective HSP length: 92 effective length of database: 60,392,734 effective search space used: 1449425616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
