| Clone Name | rbaet74c09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | COPB_RAT (P23514) Coatomer subunit beta (Beta-coat protein) (Bet... | 30 | 2.3 | 2 | COPB_MOUSE (Q9JIF7) Coatomer subunit beta (Beta-coat protein) (B... | 30 | 2.3 | 3 | COPB_HUMAN (P53618) Coatomer subunit beta (Beta-coat protein) (B... | 30 | 2.3 | 4 | CT024_MOUSE (Q9CQT9) Protein C20orf24 homolog | 28 | 8.6 |
|---|
>COPB_RAT (P23514) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 29.6 bits (65), Expect = 2.3 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = -3 Query: 201 ILTVIH-LDSVENYRGHLWLLLAWCSTR 121 +L V H + SV+ YRG LW+L +CST+ Sbjct: 442 MLEVFHAIKSVKIYRGALWILGEYCSTK 469
>COPB_MOUSE (Q9JIF7) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 29.6 bits (65), Expect = 2.3 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = -3 Query: 201 ILTVIH-LDSVENYRGHLWLLLAWCSTR 121 +L V H + SV+ YRG LW+L +CST+ Sbjct: 442 MLEVFHAIKSVKIYRGALWILGEYCSTK 469
>COPB_HUMAN (P53618) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 29.6 bits (65), Expect = 2.3 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = -3 Query: 201 ILTVIH-LDSVENYRGHLWLLLAWCSTR 121 +L V H + SV+ YRG LW+L +CST+ Sbjct: 442 MLEVFHAIKSVKIYRGALWILGEYCSTK 469
>CT024_MOUSE (Q9CQT9) Protein C20orf24 homolog| Length = 129 Score = 27.7 bits (60), Expect = 8.6 Identities = 12/38 (31%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +2 Query: 17 FIYCQRSEKNGTFE-HREGEITKYQLLRIIWIFLYRRV 127 ++ E GT+E +EG +T + L +IWI Y + Sbjct: 89 YLQIDEEEYGGTWELTKEGFMTSFALFMVIWIIFYTAI 126 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,122,723 Number of Sequences: 219361 Number of extensions: 472684 Number of successful extensions: 1318 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1307 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1318 length of database: 80,573,946 effective HSP length: 43 effective length of database: 71,141,423 effective search space used: 1707394152 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)