| Clone Name | rbaet74b10 |
|---|---|
| Clone Library Name | barley_pub |
>ALF_CICAR (O65735) Fructose-bisphosphate aldolase, cytoplasmic isozyme (EC| 4.1.2.13) Length = 359 Score = 31.2 bits (69), Expect = 0.69 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 314 GASESLHVKDYKY 276 GASESLHVKDYKY Sbjct: 347 GASESLHVKDYKY 359
>ALF2_PEA (P46257) Fructose-bisphosphate aldolase, cytoplasmic isozyme 2 (EC| 4.1.2.13) Length = 359 Score = 31.2 bits (69), Expect = 0.69 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 314 GASESLHVKDYKY 276 GASESLHVKDYKY Sbjct: 347 GASESLHVKDYKY 359
>ALF_ORYSA (P17784) Fructose-bisphosphate aldolase cytoplasmic isozyme (EC| 4.1.2.13) (Gravity-specific protein GSC 233) Length = 358 Score = 31.2 bits (69), Expect = 0.69 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 314 GASESLHVKDYKY 276 GASESLHVKDYKY Sbjct: 346 GASESLHVKDYKY 358
>CYB_EULMM (O99797) Cytochrome b| Length = 379 Score = 30.8 bits (68), Expect = 0.90 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 39 ITGPWNKNLLLQFTIRSTRFTGY 107 +TG WN ++L FT+ +T F GY Sbjct: 109 LTGTWNIGIILLFTVMATAFMGY 131
>MELK_MOUSE (Q61846) Maternal embryonic leucine zipper kinase (EC 2.7.11.1)| (Protein kinase PK38) (mPK38) Length = 643 Score = 28.9 bits (63), Expect = 3.4 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = +1 Query: 43 QDHGTKTCCSNLRYAAPDL-QGIHQLQKE 126 +D+ +TCC +L YAAP+L QG L E Sbjct: 161 KDYHLQTCCGSLAYAAPELIQGKSYLGSE 189
>ALF_SPIOL (P29356) Fructose-bisphosphate aldolase, cytoplasmic isozyme (EC| 4.1.2.13) Length = 357 Score = 28.9 bits (63), Expect = 3.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 311 ASESLHVKDYKY 276 ASESLHVKDYKY Sbjct: 346 ASESLHVKDYKY 357
>ALF1_PEA (P46256) Fructose-bisphosphate aldolase, cytoplasmic isozyme 1 (EC| 4.1.2.13) Length = 357 Score = 28.9 bits (63), Expect = 3.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 311 ASESLHVKDYKY 276 ASESLHVKDYKY Sbjct: 346 ASESLHVKDYKY 357
>MELK_HUMAN (Q14680) Maternal embryonic leucine zipper kinase (EC 2.7.11.1)| (hMELK) (Protein kinase PK38) (hPK38) Length = 651 Score = 28.9 bits (63), Expect = 3.4 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = +1 Query: 43 QDHGTKTCCSNLRYAAPDL-QGIHQLQKE 126 +D+ +TCC +L YAAP+L QG L E Sbjct: 161 KDYHLQTCCGSLAYAAPELIQGKSYLGSE 189
>CYB_ZALCA (Q36266) Cytochrome b| Length = 379 Score = 28.5 bits (62), Expect = 4.5 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 30 SRKITGPWNKNLLLQFTIRSTRFTGY 107 S +T WN ++L FTI +T F GY Sbjct: 106 SYTLTETWNIGIILLFTIMATAFMGY 131
>CYB_EUMJU (Q34471) Cytochrome b| Length = 379 Score = 28.5 bits (62), Expect = 4.5 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 30 SRKITGPWNKNLLLQFTIRSTRFTGY 107 S +T WN ++L FTI +T F GY Sbjct: 106 SYTLTETWNIGIILLFTIMATAFMGY 131
>CYB_EULMF (O99798) Cytochrome b| Length = 379 Score = 28.5 bits (62), Expect = 4.5 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 39 ITGPWNKNLLLQFTIRSTRFTGY 107 +T WN ++L FT+ +T F GY Sbjct: 109 LTETWNMGIILLFTVMATAFMGY 131
>CYB_ARCGZ (Q33688) Cytochrome b| Length = 379 Score = 28.5 bits (62), Expect = 4.5 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 30 SRKITGPWNKNLLLQFTIRSTRFTGY 107 S +T WN ++L FTI +T F GY Sbjct: 106 SYTLTETWNIGIILLFTIMATAFMGY 131
>CP51_ISSOR (Q02315) Cytochrome P450 51 (EC 1.14.13.70) (CYPLI) (P450-LIA1)| (Sterol 14-alpha demethylase) (Lanosterol 14-alpha demethylase) (P450-14DM) (Fragment) Length = 414 Score = 28.5 bits (62), Expect = 4.5 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = +2 Query: 23 LYEQENYRTMEQKPAAPIYDTQHPIYRVFINSKKKLLRYYESKF 154 +Y+ N++ MEQK A + T+ R K ++L+Y+ + F Sbjct: 77 IYDCPNWKLMEQKKFAKVALTKESFIRYVPLIKDEMLKYFNANF 120
>TRI4_FUSSP (Q12612) Trichodiene oxygenase (EC 1.14.-.-) (Cytochrome P450 58)| Length = 520 Score = 28.1 bits (61), Expect = 5.8 Identities = 16/54 (29%), Positives = 25/54 (46%) Frame = -1 Query: 264 RWVAVARLGVPLTSIIVWFSES*DISFGYRTSFLIMLNLLS*YRSSFFLELMNT 103 RW+ A +PL I FS+ GY +F M +S ++ +EL +T Sbjct: 430 RWIEAAEKKIPLKKYITNFSQGSRQCIGYTMAFAEMYLAMSRIARAYDVELYDT 483
>CYB_HYSAF (Q04910) Cytochrome b| Length = 384 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 Query: 30 SRKITGPWNKNLLLQFTIRSTRFTGY 107 S T WN +LL FT+ +T F GY Sbjct: 106 SYMFTETWNIGILLLFTVMATAFMGY 131
>CYB_PROSA (Q6ELU8) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 7.6 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 42 TGPWNKNLLLQFTIRSTRFTGY 107 T WN +LL FT+ +T F GY Sbjct: 110 TETWNIGILLLFTVMATAFMGY 131
>CYB_OMMRO (Q678S8) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 7.6 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 Query: 30 SRKITGPWNKNLLLQFTIRSTRFTGY 107 S T WN ++L FTI +T F GY Sbjct: 106 SYTFTETWNIGIILLFTIMATAFMGY 131
>CYB_MIRLE (Q35019) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 7.6 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 Query: 30 SRKITGPWNKNLLLQFTIRSTRFTGY 107 S T WN ++L FTI +T F GY Sbjct: 106 SYTFTETWNIGIILLFTIMATAFMGY 131
>CYB_MICMU (Q9G0S9) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 7.6 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 39 ITGPWNKNLLLQFTIRSTRFTGY 107 +T WN ++L FT+ +T F GY Sbjct: 109 LTETWNIGIILLFTVMATAFMGY 131
>CYB_LOBCR (Q678S9) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 7.6 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 Query: 30 SRKITGPWNKNLLLQFTIRSTRFTGY 107 S T WN ++L FTI +T F GY Sbjct: 106 SYTFTETWNIGIILLFTIMATAFMGY 131
>CYB_HALGR (P38593) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 7.6 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 Query: 30 SRKITGPWNKNLLLQFTIRSTRFTGY 107 S T WN ++L FTI +T F GY Sbjct: 106 SYTFTETWNIGIILLFTIMATAFMGY 131
>CYB_GALEE (Q85PP0) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 7.6 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 30 SRKITGPWNKNLLLQFTIRSTRFTGY 107 S + WN +LL FT+ +T F GY Sbjct: 106 SHTFSETWNVGILLLFTVMATAFMGY 131
>CYB_EULRU (O99800) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 7.6 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 39 ITGPWNKNLLLQFTIRSTRFTGY 107 +T WN ++L FT+ +T F GY Sbjct: 109 LTETWNIGIILLFTVMATAFMGY 131
>CYB_EULMO (O99799) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 7.6 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 39 ITGPWNKNLLLQFTIRSTRFTGY 107 +T WN ++L FT+ +T F GY Sbjct: 109 LTETWNIGIILLFTVMATAFMGY 131
>CYB_EULFC (Q34459) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 7.6 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 39 ITGPWNKNLLLQFTIRSTRFTGY 107 +T WN ++L FT+ +T F GY Sbjct: 109 LTETWNIGIILLFTVMATAFMGY 131
>CYB_EULCO (Q5VJ65) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 7.6 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 39 ITGPWNKNLLLQFTIRSTRFTGY 107 +T WN ++L FT+ +T F GY Sbjct: 109 LTETWNIGIILLFTVMATAFMGY 131
>CYB_PHOVI (Q00530) Cytochrome b| Length = 379 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 30 SRKITGPWNKNLLLQFTIRSTRFTGY 107 S T WN ++L FT+ +T F GY Sbjct: 106 SYTFTETWNIGIILLFTVMATAFMGY 131
>CYB_PHOLR (Q35505) Cytochrome b| Length = 379 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 30 SRKITGPWNKNLLLQFTIRSTRFTGY 107 S T WN ++L FT+ +T F GY Sbjct: 106 SYTFTETWNIGIILLFTVMATAFMGY 131
>CYB_PHOHI (Q35468) Cytochrome b| Length = 379 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 30 SRKITGPWNKNLLLQFTIRSTRFTGY 107 S T WN ++L FT+ +T F GY Sbjct: 106 SYTFTETWNIGIILLFTVMATAFMGY 131
>CYB_PHOGR (Q35457) Cytochrome b| Length = 379 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 30 SRKITGPWNKNLLLQFTIRSTRFTGY 107 S T WN ++L FT+ +T F GY Sbjct: 106 SYTFTETWNIGIILLFTVMATAFMGY 131
>CYB_PHOFA (Q35438) Cytochrome b| Length = 379 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 30 SRKITGPWNKNLLLQFTIRSTRFTGY 107 S T WN ++L FT+ +T F GY Sbjct: 106 SYTFTETWNIGIILLFTVMATAFMGY 131
>CYB_LEPWE (P38594) Cytochrome b| Length = 379 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 30 SRKITGPWNKNLLLQFTIRSTRFTGY 107 S T WN ++L FT+ +T F GY Sbjct: 106 SYTFTETWNIGIILLFTVMATAFMGY 131
>CYB_HYDLE (Q34732) Cytochrome b| Length = 379 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 30 SRKITGPWNKNLLLQFTIRSTRFTGY 107 S T WN ++L FT+ +T F GY Sbjct: 106 SYTFTETWNIGIILLFTVMATAFMGY 131
>CYB_DRYNI (O03713) Cytochrome b| Length = 379 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 30 SRKITGPWNKNLLLQFTIRSTRFTGY 107 S T WN ++L FT+ +T F GY Sbjct: 106 SYSYTETWNIGIILLFTVMATAFMGY 131
>CYB_CYSCR (Q34070) Cytochrome b| Length = 379 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 30 SRKITGPWNKNLLLQFTIRSTRFTGY 107 S T WN ++L FT+ +T F GY Sbjct: 106 SYTFTETWNIGIILLFTVMATAFMGY 131
>DNAK_CHLCV (Q824B2) Chaperone protein dnaK (Heat shock protein 70) (Heat shock| 70 kDa protein) (HSP70) Length = 664 Score = 27.3 bits (59), Expect = 9.9 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -1 Query: 315 GRLREPSRQGLQVLIDLRWVAVARLGVPLTSIIV 214 G+ P G QVLI ++ A A LG P+T ++ Sbjct: 110 GKQYTPEEIGAQVLIKMKETAEAYLGEPVTEAVI 143
>CYB_GYMRO (Q9T7Q5) Cytochrome b| Length = 380 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 30 SRKITGPWNKNLLLQFTIRSTRFTGY 107 S T WN ++L FT+ +T F GY Sbjct: 106 SYTFTETWNIGIILLFTVMATAFMGY 131
>GCH1_THETN (Q8R7N2) GTP cyclohydrolase I (EC 3.5.4.16) (GTP-CH-I)| Length = 188 Score = 27.3 bits (59), Expect = 9.9 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +2 Query: 110 INSKKKLLRYYESKFSIIKNEVRYPKDISQDSENQTMILVSGTP 241 + + ++ R YE FS + +V+ I Q+ E+Q +ILV P Sbjct: 28 LETPDRVARMYEEIFSGLHTDVKDVIKIFQEDEHQEIILVKDIP 71 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,798,630 Number of Sequences: 219361 Number of extensions: 888132 Number of successful extensions: 3297 Number of sequences better than 10.0: 38 Number of HSP's better than 10.0 without gapping: 3250 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3297 length of database: 80,573,946 effective HSP length: 80 effective length of database: 63,025,066 effective search space used: 1512601584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)