| Clone Name | rbaet74b01 |
|---|---|
| Clone Library Name | barley_pub |
>E75BB_DROME (P13055) Ecdysone-induced protein 75B isoform B (E75-C)| Length = 1412 Score = 31.2 bits (69), Expect = 0.72 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 35 HKTVVASQHVQEPRSRPDSHTHKVNKQQSRAHQTH 139 H V+AS H Q+ + + + H+ QQ + HQ H Sbjct: 313 HVNVIASNHFQQQQQQHQAQQHQQQHQQHQQHQQH 347
>MOT3_YEAST (P54785) Transcriptional activator/repressor MOT3 (Modulator of| transcription protein 3) (Hypoxic gene repressor protein 7) Length = 490 Score = 30.8 bits (68), Expect = 0.94 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 5/51 (9%) Frame = +2 Query: 50 ASQHVQEPRSRPDSHTHKVNKQQSRAH----QTHTRIQR-ANTDDVGTASL 187 A H+Q+ + + H + ++QQ H Q HT +Q +NT+++G+ SL Sbjct: 3 ADHHLQQQQQQRQQHQQQQHQQQQHQHQHQQQQHTILQNVSNTNNIGSDSL 53
>RL4_METAC (Q8TRU6) 50S ribosomal protein L4P| Length = 253 Score = 30.4 bits (67), Expect = 1.2 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +1 Query: 82 ARQPHAQGKQTAITCTPNAYKNTKSKYRRRRHGVPTACAVTS 207 AR PHA+G + A P A ++ K + RR+ + +A A T+ Sbjct: 81 ARVPHAKGGRRAHPPKPEADRSEKVNTKERRYAIRSAIAATT 122
>RL4_METMA (Q8PV49) 50S ribosomal protein L4P| Length = 253 Score = 30.0 bits (66), Expect = 1.6 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +1 Query: 82 ARQPHAQGKQTAITCTPNAYKNTKSKYRRRRHGVPTACAVT 204 AR PHA+G + A P A ++ K + RR+ + +A A T Sbjct: 81 ARVPHAKGGRRAHPPKPEADRSEKVNTKERRYAIRSAIAAT 121
>H15_DROME (Q94890) T-box protein H15| Length = 660 Score = 28.1 bits (61), Expect = 6.1 Identities = 12/47 (25%), Positives = 20/47 (42%) Frame = +2 Query: 44 VVASQHVQEPRSRPDSHTHKVNKQQSRAHQTHTRIQRANTDDVGTAS 184 V Q Q+ + R +H H +Q R H H N+ + G ++ Sbjct: 166 VAQQQQQQQQQQRQQTHHHATTGKQQRQHHNHHSSNTNNSSNSGNSN 212
>CCD13_HUMAN (Q8IYE1) Coiled-coil domain-containing protein 13| Length = 715 Score = 27.7 bits (60), Expect = 8.0 Identities = 18/58 (31%), Positives = 27/58 (46%) Frame = +2 Query: 11 QSKLNYYYHKTVVASQHVQEPRSRPDSHTHKVNKQQSRAHQTHTRIQRANTDDVGTAS 184 + KL H+TVV QH+++ R P K + Q A +T T + +N T S Sbjct: 585 ERKLQEERHRTVVLEQHLEKIRLEPG----KASASQRAAPRTKTGLPTSNNRHNPTGS 638
>UPL2_ARATH (Q8H0T4) E3 ubiquitin protein ligase UPL2 (EC 6.3.2.-)| (Ubiquitin-protein ligase 2) Length = 3658 Score = 27.7 bits (60), Expect = 8.0 Identities = 20/57 (35%), Positives = 25/57 (43%) Frame = +1 Query: 49 SITTRTRAEI*ARQPHAQGKQTAITCTPNAYKNTKSKYRRRRHGVPTACAVTSLMQS 219 S+ T TRA A Q ++ PN KNT S R HG T+ V L Q+ Sbjct: 1993 SLETLTRAANAAEQLKSE--------VPNEQKNTDSDERHDSHGTSTSTEVDELNQN 2041
>ADAM8_MOUSE (Q05910) ADAM 8 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase domain 8) (Cell surface antigen MS2) (Macrophage cysteine-rich glycoprotein) (CD156 antigen) Length = 826 Score = 27.7 bits (60), Expect = 8.0 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -1 Query: 129 CARDCCLFTLCVWLSGLDLGSCTCC 55 C CC T C + G + S TCC Sbjct: 425 CQNPCCNATTCQLVKGAECASGTCC 449 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,982,043 Number of Sequences: 219361 Number of extensions: 590492 Number of successful extensions: 1747 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1717 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1747 length of database: 80,573,946 effective HSP length: 66 effective length of database: 66,096,120 effective search space used: 1586306880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)