| Clone Name | rbaet73a07 |
|---|---|
| Clone Library Name | barley_pub |
>COPB_RAT (P23514) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 30.0 bits (66), Expect = 1.6 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -2 Query: 214 QILTVIH-LDSVENYRGHLWLLLAWCSTR 131 ++L V H + SV+ YRG LW+L +CST+ Sbjct: 441 KMLEVFHAIKSVKIYRGALWILGEYCSTK 469
>COPB_MOUSE (Q9JIF7) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 30.0 bits (66), Expect = 1.6 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -2 Query: 214 QILTVIH-LDSVENYRGHLWLLLAWCSTR 131 ++L V H + SV+ YRG LW+L +CST+ Sbjct: 441 KMLEVFHAIKSVKIYRGALWILGEYCSTK 469
>COPB_HUMAN (P53618) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 30.0 bits (66), Expect = 1.6 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -2 Query: 214 QILTVIH-LDSVENYRGHLWLLLAWCSTR 131 ++L V H + SV+ YRG LW+L +CST+ Sbjct: 441 KMLEVFHAIKSVKIYRGALWILGEYCSTK 469
>VNUC_MABVM (P27588) Nucleoprotein (Nucleocapsid protein)| Length = 692 Score = 28.9 bits (63), Expect = 3.6 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = -2 Query: 250 LNLSPEESLSG*QILTVIHLDSVENYRGHLWLLLAWCS 137 L++SP E IL + L+S E+ RG + L L++CS Sbjct: 100 LDVSPNEPHYSPLILALKTLESTESQRGRIGLFLSFCS 137
>Y2658_LISIN (Q927X9) Hypothetical UPF0230 protein lin2658| Length = 283 Score = 27.7 bits (60), Expect = 8.1 Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 2/60 (3%) Frame = +1 Query: 19 DNSSYIVNEVKKTVHSNTEKEK--LQNTNYCE*SGSFCTAEYYTTLRAAKDAPDSSQRYP 192 D+++Y+ +EVK+ + N + +Y E TA++Y ++ A++ P SSQ P Sbjct: 10 DSTTYLPDEVKEQLRINVVPLSVIIDGKSYRE-GEELSTADFYKKVKEAENFPTSSQPAP 68
>CT024_MOUSE (Q9CQT9) Protein C20orf24 homolog| Length = 129 Score = 27.7 bits (60), Expect = 8.1 Identities = 12/38 (31%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +3 Query: 27 FIYCQRSEENGTFE-HREGEITKYQLLRIIWIFLYRRV 137 ++ E GT+E +EG +T + L +IWI Y + Sbjct: 89 YLQIDEEEYGGTWELTKEGFMTSFALFMVIWIIFYTAI 126 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,099,086 Number of Sequences: 219361 Number of extensions: 623720 Number of successful extensions: 1481 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1470 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1481 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)