| Clone Name | rbaet72g10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZN434_HUMAN (Q9NX65) Zinc finger protein 434 | 31 | 0.84 | 2 | PLVAP_MOUSE (Q91VC4) Plasmalemma vesicle-associated protein (Pla... | 28 | 4.2 | 3 | 3CL_HUMAN (Q13412) Pre-T/NK cell-associated protein 3Cl | 28 | 5.5 |
|---|
>ZN434_HUMAN (Q9NX65) Zinc finger protein 434| Length = 485 Score = 30.8 bits (68), Expect = 0.84 Identities = 20/57 (35%), Positives = 24/57 (42%), Gaps = 4/57 (7%) Frame = +2 Query: 152 SRLYKARSGHPRDTRERQCHDDRIHQSDK*PSQEAIKRK----RPAACTRRHCGDPC 310 S L K P T RQC + +K PSQE + + R ACT CG C Sbjct: 237 SELQKGLESEP--TSRRQCRNSPGESEEKTPSQEKMSHQSFCARDKACTHILCGKNC 291
>PLVAP_MOUSE (Q91VC4) Plasmalemma vesicle-associated protein (Plasmalemma| vesicle protein 1) (PV-1) (MECA-32 antigen) Length = 438 Score = 28.5 bits (62), Expect = 4.2 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -2 Query: 104 DQQEGCVYFFSSLILWQTIIYVTDYYGVIYFILY 3 DQQ GC Y+ L+ ++I G++ F++Y Sbjct: 15 DQQRGCWYYLRYFFLFVSLIQFLIILGLVLFMIY 48
>3CL_HUMAN (Q13412) Pre-T/NK cell-associated protein 3Cl| Length = 51 Score = 28.1 bits (61), Expect = 5.5 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = -1 Query: 321 QEQPQGSPQWR---RVQAAGRLRLIASWLGYLSL*WMRSSWHCRSRVS 187 QE WR R ++ R + I SWL YLS + +SW+C+ ++S Sbjct: 5 QETVYSCEYWRTFKRYFSSWRFK-IRSWLTYLSWGLLCTSWYCKVKMS 51 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,283,550 Number of Sequences: 219361 Number of extensions: 633653 Number of successful extensions: 1303 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1290 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1303 length of database: 80,573,946 effective HSP length: 97 effective length of database: 59,295,929 effective search space used: 1423102296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)