| Clone Name | rbaet72d08 |
|---|---|
| Clone Library Name | barley_pub |
>EXPB4_ARATH (Q9SHD1) Putative beta-expansin 4 precursor (AtEXPB4) (At-EXPB4)| (Ath-ExpBeta-1.1) Length = 259 Score = 34.3 bits (77), Expect = 0.12 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -3 Query: 418 NVIPANWRPNTDYRSFVQF 362 NVIPANW+P+ YRS V F Sbjct: 241 NVIPANWKPDESYRSIVNF 259
>MPAC1_CYNDA (O04701) Major pollen allergen Cyn d 1| Length = 246 Score = 31.2 bits (69), Expect = 1.0 Identities = 12/20 (60%), Positives = 17/20 (85%) Frame = -3 Query: 421 NNVIPANWRPNTDYRSFVQF 362 ++VIPANW+P+T Y S +QF Sbjct: 225 DDVIPANWKPDTVYTSKLQF 244
>EXB1A_MAIZE (P58738) Beta-expansin 1a precursor (Pollen allergen Zea m 1) (Zea| m I) Length = 269 Score = 31.2 bits (69), Expect = 1.0 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -3 Query: 418 NVIPANWRPNTDYRSFVQF 362 +VIPANWRP+ Y S VQF Sbjct: 250 DVIPANWRPDAVYTSNVQF 268
>EXPB2_ARATH (Q9SHY6) Putative beta-expansin 2 precursor (AtEXPB2) (At-EXPB2)| (Ath-ExpBeta-1.4) Length = 273 Score = 30.8 bits (68), Expect = 1.4 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -3 Query: 421 NNVIPANWRPNTDYRSFVQF 362 +NVIPANW+P Y+S V F Sbjct: 254 SNVIPANWQPGAIYKSNVNF 273
>EXB1B_MAIZE (Q07154) Beta-expansin 1b (Pollen allergen Zea m 1) (Zea m I)| (Fragment) Length = 191 Score = 30.8 bits (68), Expect = 1.4 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -3 Query: 418 NVIPANWRPNTDYRSFVQF 362 ++IPANWRP+ Y S VQF Sbjct: 172 DIIPANWRPDAVYTSNVQF 190
>YNL6_YEAST (P53924) RING finger protein YNL116W| Length = 522 Score = 28.1 bits (61), Expect = 8.8 Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -1 Query: 108 CALPPTDSVYGVPCI-TWHYLCVTKIPNQSY 19 C + P +++ PC +WH+ CV ++ SY Sbjct: 438 CKIKPCQAIFISPCAHSWHFRCVRRLVMLSY 468
>SUR2_CAEEL (Q10669) Protein sur-2| Length = 1587 Score = 28.1 bits (61), Expect = 8.8 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 14/55 (25%) Frame = -2 Query: 422 QQCHPGQLEAQHRLPLLRPVQLIGPDRPMS---------GHVRL-----HHARMH 300 Q HP Q + QH++P + Q +GP P + GHV + HH + H Sbjct: 1473 QSNHPTQQQLQHQIPNMSMHQQMGPQYPGAVFHHPSGPVGHVPMQYGMGHHMQQH 1527 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,275,093 Number of Sequences: 219361 Number of extensions: 1163690 Number of successful extensions: 3312 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3054 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3311 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)