| Clone Name | rbaet71h11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | E75BB_DROME (P13055) Ecdysone-induced protein 75B isoform B (E75-C) | 31 | 0.99 | 2 | MOT3_YEAST (P54785) Transcriptional activator/repressor MOT3 (Mo... | 31 | 1.3 | 3 | RL4_METAC (Q8TRU6) 50S ribosomal protein L4P | 30 | 1.7 | 4 | RL4_METMA (Q8PV49) 50S ribosomal protein L4P | 30 | 2.2 | 5 | MEGF6_HUMAN (O75095) Multiple epidermal growth factor-like domai... | 29 | 3.7 | 6 | CCD13_HUMAN (Q8IYE1) Coiled-coil domain-containing protein 13 | 28 | 8.3 | 7 | H15_DROME (Q94890) T-box protein H15 | 28 | 8.3 | 8 | CYSQ_SHIFL (P59735) Protein cysQ | 28 | 8.3 | 9 | CYSQ_ECOLI (P22255) Protein cysQ | 28 | 8.3 | 10 | CYSQ_ECOL6 (Q8FAG5) Protein cysQ | 28 | 8.3 | 11 | CYSQ_ECO57 (Q8XCG6) Protein cysQ | 28 | 8.3 |
|---|
>E75BB_DROME (P13055) Ecdysone-induced protein 75B isoform B (E75-C)| Length = 1412 Score = 31.2 bits (69), Expect = 0.99 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +3 Query: 42 HKTVVASQHVQEPRSRPDSHTHKVNKQQSRAHQTH 146 H V+AS H Q+ + + + H+ QQ + HQ H Sbjct: 313 HVNVIASNHFQQQQQQHQAQQHQQQHQQHQQHQQH 347
>MOT3_YEAST (P54785) Transcriptional activator/repressor MOT3 (Modulator of| transcription protein 3) (Hypoxic gene repressor protein 7) Length = 490 Score = 30.8 bits (68), Expect = 1.3 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 5/51 (9%) Frame = +3 Query: 57 ASQHVQEPRSRPDSHTHKVNKQQSRAH----QTHTRIQR-ANTDDVGTASL 194 A H+Q+ + + H + ++QQ H Q HT +Q +NT+++G+ SL Sbjct: 3 ADHHLQQQQQQRQQHQQQQHQQQQHQHQHQQQQHTILQNVSNTNNIGSDSL 53
>RL4_METAC (Q8TRU6) 50S ribosomal protein L4P| Length = 253 Score = 30.4 bits (67), Expect = 1.7 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +2 Query: 89 ARQPHAQGKQTAITCTPNAYKNTKSKYRRRRHGVPTACAVTS 214 AR PHA+G + A P A ++ K + RR+ + +A A T+ Sbjct: 81 ARVPHAKGGRRAHPPKPEADRSEKVNTKERRYAIRSAIAATT 122
>RL4_METMA (Q8PV49) 50S ribosomal protein L4P| Length = 253 Score = 30.0 bits (66), Expect = 2.2 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +2 Query: 89 ARQPHAQGKQTAITCTPNAYKNTKSKYRRRRHGVPTACAVT 211 AR PHA+G + A P A ++ K + RR+ + +A A T Sbjct: 81 ARVPHAKGGRRAHPPKPEADRSEKVNTKERRYAIRSAIAAT 121
>MEGF6_HUMAN (O75095) Multiple epidermal growth factor-like domains 6 precursor| (EGF-like domain-containing protein 3) (Multiple EGF-like domain protein 3) Length = 1229 Score = 29.3 bits (64), Expect = 3.7 Identities = 24/90 (26%), Positives = 29/90 (32%), Gaps = 5/90 (5%) Frame = -1 Query: 409 NCIPGFANQRGPAECASFLSQPK-----TCPSASARVACPAADAQSNXAAPGARVAEDYS 245 +C GF +R AEC P TCP VAC + + P ED Sbjct: 567 SCKAGFRGERCQAECELGYFGPGCWQACTCPVG---VACDSVSGECGKRCPAGFQGEDCG 623 Query: 244 SYVVYATLHE*GDSACSRDAVPTSSVFALC 155 T S+CS P V C Sbjct: 624 QECPVGTFGVNCSSSCSCGGAPCHGVTGQC 653
>CCD13_HUMAN (Q8IYE1) Coiled-coil domain-containing protein 13| Length = 715 Score = 28.1 bits (61), Expect = 8.3 Identities = 19/62 (30%), Positives = 29/62 (46%) Frame = +3 Query: 6 LKKIQSKLNYYYHKTVVASQHVQEPRSRPDSHTHKVNKQQSRAHQTHTRIQRANTDDVGT 185 L + + KL H+TVV QH+++ R P K + Q A +T T + +N T Sbjct: 581 LLESERKLQEERHRTVVLEQHLEKIRLEPG----KASASQRAAPRTKTGLPTSNNRHNPT 636 Query: 186 AS 191 S Sbjct: 637 GS 638
>H15_DROME (Q94890) T-box protein H15| Length = 660 Score = 28.1 bits (61), Expect = 8.3 Identities = 12/47 (25%), Positives = 20/47 (42%) Frame = +3 Query: 51 VVASQHVQEPRSRPDSHTHKVNKQQSRAHQTHTRIQRANTDDVGTAS 191 V Q Q+ + R +H H +Q R H H N+ + G ++ Sbjct: 166 VAQQQQQQQQQQRQQTHHHATTGKQQRQHHNHHSSNTNNSSNSGNSN 212
>CYSQ_SHIFL (P59735) Protein cysQ| Length = 246 Score = 28.1 bits (61), Expect = 8.3 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 291 WASAAGHATRALAEGHVFGW 350 W +AAGHA A A HV W Sbjct: 204 WDTAAGHAVAAAAGAHVHDW 223
>CYSQ_ECOLI (P22255) Protein cysQ| Length = 246 Score = 28.1 bits (61), Expect = 8.3 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 291 WASAAGHATRALAEGHVFGW 350 W +AAGHA A A HV W Sbjct: 204 WDTAAGHAVAAAAGAHVHDW 223
>CYSQ_ECOL6 (Q8FAG5) Protein cysQ| Length = 246 Score = 28.1 bits (61), Expect = 8.3 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 291 WASAAGHATRALAEGHVFGW 350 W +AAGHA A A HV W Sbjct: 204 WDTAAGHAVAAAAGAHVHDW 223
>CYSQ_ECO57 (Q8XCG6) Protein cysQ| Length = 246 Score = 28.1 bits (61), Expect = 8.3 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 291 WASAAGHATRALAEGHVFGW 350 W +AAGHA A A HV W Sbjct: 204 WDTAAGHAVAAAAGAHVHDW 223 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,623,206 Number of Sequences: 219361 Number of extensions: 842817 Number of successful extensions: 2869 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2768 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2869 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)