| Clone Name | rbaet71f12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CD8A_CANFA (P33706) T-cell surface glycoprotein CD8 alpha chain ... | 28 | 5.9 | 2 | PPNK_PARUW (Q6MDK7) Probable inorganic polyphosphate/ATP-NAD kin... | 28 | 7.7 |
|---|
>CD8A_CANFA (P33706) T-cell surface glycoprotein CD8 alpha chain precursor| (CD8a antigen) Length = 239 Score = 28.1 bits (61), Expect = 5.9 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = +3 Query: 192 RATAPSGPARVRRRPPDVEEAAICMGKLQAAVE 290 RA A SGP+R R PP V +G+L A VE Sbjct: 17 RAAAASGPSRFRMTPPKV------VGQLHAQVE 43
>PPNK_PARUW (Q6MDK7) Probable inorganic polyphosphate/ATP-NAD kinase (EC| 2.7.1.23) (Poly(P)/ATP NAD kinase) Length = 279 Score = 27.7 bits (60), Expect = 7.7 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = -2 Query: 115 LLPHIFFGSAVVTS-SISVRVFVLEAYIPEDICSDGIS 5 + PH +V IS++V L +Y P ++ SDGIS Sbjct: 197 ICPHTISNRPIVLMPEISIQVKYLSSYAPVEVSSDGIS 234 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,702,020 Number of Sequences: 219361 Number of extensions: 459700 Number of successful extensions: 1093 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1077 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1093 length of database: 80,573,946 effective HSP length: 76 effective length of database: 63,902,510 effective search space used: 1533660240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)