| Clone Name | rbaet71d07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GTOMC_ARATH (Q9ZSK1) Tocopherol O-methyltransferase, chloroplast... | 60 | 2e-09 | 2 | GSH2_MOUSE (P31316) Homeobox protein GSH-2 | 29 | 3.5 | 3 | GSH2_HUMAN (Q9BZM3) Homeobox protein GSH-2 | 29 | 3.5 | 4 | YAS9_SCHPO (Q10145) Hypothetical RNA-binding protein C3H8.09c in... | 28 | 7.8 |
|---|
>GTOMC_ARATH (Q9ZSK1) Tocopherol O-methyltransferase, chloroplast precursor (EC| 2.1.1.95) (Gamma-tocopherol methyltransferase) Length = 348 Score = 59.7 bits (143), Expect = 2e-09 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -1 Query: 287 SGWKTIKGALVMPLMIQGYKKGLIKFTIITCRKP 186 SG K+IKGAL MPLMI+GYKKG+IKF IITC+KP Sbjct: 314 SGMKSIKGALTMPLMIEGYKKGVIKFGIITCQKP 347
>GSH2_MOUSE (P31316) Homeobox protein GSH-2| Length = 305 Score = 28.9 bits (63), Expect = 3.5 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 6/33 (18%) Frame = -3 Query: 258 GDASHDPRLQER------PDQVHHHHLPQTPSS 178 GDA PR+ P HHHH PQ P S Sbjct: 114 GDAQFCPRVSHAHHHHHPPQHHHHHHQPQQPGS 146
>GSH2_HUMAN (Q9BZM3) Homeobox protein GSH-2| Length = 304 Score = 28.9 bits (63), Expect = 3.5 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 6/33 (18%) Frame = -3 Query: 258 GDASHDPRLQER------PDQVHHHHLPQTPSS 178 GDA PR+ P HHHH PQ P S Sbjct: 114 GDAQFCPRVNHAHHHHHPPQHHHHHHQPQQPGS 146
>YAS9_SCHPO (Q10145) Hypothetical RNA-binding protein C3H8.09c in chromosome I| Length = 738 Score = 27.7 bits (60), Expect = 7.8 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -3 Query: 240 PRLQERPDQVHHHHLPQTPSS 178 P +++H HH PQTPSS Sbjct: 279 PNYYNEHNELHEHHNPQTPSS 299 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,306,215 Number of Sequences: 219361 Number of extensions: 690845 Number of successful extensions: 2078 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1936 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2061 length of database: 80,573,946 effective HSP length: 71 effective length of database: 64,999,315 effective search space used: 1559983560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)