| Clone Name | rbaet71b11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | COPB_RAT (P23514) Coatomer subunit beta (Beta-coat protein) (Bet... | 30 | 1.6 | 2 | COPB_MOUSE (Q9JIF7) Coatomer subunit beta (Beta-coat protein) (B... | 30 | 1.6 | 3 | COPB_HUMAN (P53618) Coatomer subunit beta (Beta-coat protein) (B... | 30 | 1.6 | 4 | VNUC_MABVM (P27588) Nucleoprotein (Nucleocapsid protein) | 29 | 3.5 | 5 | CT024_MOUSE (Q9CQT9) Protein C20orf24 homolog | 28 | 7.8 |
|---|
>COPB_RAT (P23514) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 30.0 bits (66), Expect = 1.6 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -3 Query: 204 QILTVIH-LDSVENYRGHLWLLLAWCSTR 121 ++L V H + SV+ YRG LW+L +CST+ Sbjct: 441 KMLEVFHAIKSVKIYRGALWILGEYCSTK 469
>COPB_MOUSE (Q9JIF7) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 30.0 bits (66), Expect = 1.6 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -3 Query: 204 QILTVIH-LDSVENYRGHLWLLLAWCSTR 121 ++L V H + SV+ YRG LW+L +CST+ Sbjct: 441 KMLEVFHAIKSVKIYRGALWILGEYCSTK 469
>COPB_HUMAN (P53618) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 30.0 bits (66), Expect = 1.6 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -3 Query: 204 QILTVIH-LDSVENYRGHLWLLLAWCSTR 121 ++L V H + SV+ YRG LW+L +CST+ Sbjct: 441 KMLEVFHAIKSVKIYRGALWILGEYCSTK 469
>VNUC_MABVM (P27588) Nucleoprotein (Nucleocapsid protein)| Length = 692 Score = 28.9 bits (63), Expect = 3.5 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = -3 Query: 240 LNLSPEESLSG*QILTVIHLDSVENYRGHLWLLLAWCS 127 L++SP E IL + L+S E+ RG + L L++CS Sbjct: 100 LDVSPNEPHYSPLILALKTLESTESQRGRIGLFLSFCS 137
>CT024_MOUSE (Q9CQT9) Protein C20orf24 homolog| Length = 129 Score = 27.7 bits (60), Expect = 7.8 Identities = 12/38 (31%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +2 Query: 17 FIYCQRSEENGTFE-HREGEITKYQLLRIIWIFLYRRV 127 ++ E GT+E +EG +T + L +IWI Y + Sbjct: 89 YLQIDEEEYGGTWELTKEGFMTSFALFMVIWIIFYTAI 126 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,940,169 Number of Sequences: 219361 Number of extensions: 761029 Number of successful extensions: 1750 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1734 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1750 length of database: 80,573,946 effective HSP length: 74 effective length of database: 64,341,232 effective search space used: 1544189568 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)