ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaet70f02 |
|---|---|
| Clone Library Name | barley_pub |
>FBLN2_HUMAN (P98095) Fibulin-2 precursor| Length = 1184 Score = 32.3 bits (72), Expect = 0.28 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = +3 Query: 18 RSVIPERHPFYRGRRSQPKLASPFQNRTNSATPVPPPKLCTCTCFFPCPSDC 173 R+ PE HP +P L S F ++ P+P P+ TC PC C Sbjct: 642 RTCRPEGHPPQPEAPQEPALKSEFSQVASNTIPLPLPQPNTCKDNGPCKQVC 693
>WEB1_YEAST (P38968) Protein WEB1 (Protein transport protein SEC31)| Length = 1273 Score = 32.0 bits (71), Expect = 0.36 Identities = 15/26 (57%), Positives = 19/26 (73%), Gaps = 4/26 (15%) Frame = +3 Query: 63 SQPKLASPFQNRTNSATPV----PPP 128 SQP +ASPF N+TNS+T + PPP Sbjct: 830 SQPSMASPFVNKTNSSTRLNSFAPPP 855
>PHAC_METEX (P52070) Poly(3-hydroxyalkanoate) polymerase (EC 2.3.1.-) (PHA| polymerase) (PHA synthase) (Polyhydroxyalkanoic acid synthase) Length = 605 Score = 31.2 bits (69), Expect = 0.61 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -2 Query: 125 RGDWGRRIGSVLKGACEFWLATPT--PVKWMPFWY 27 + +G R G +G E W+A T P W P+WY Sbjct: 535 KAKYGFRTGGPARGRFEDWVAAATEHPGSWWPYWY 569
>PIN1B_ORYSA (P0C0X5) Probable auxin efflux carrier component 1b (OsPIN1b)| Length = 554 Score = 30.8 bits (68), Expect = 0.80 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 408 LIALPITLVXYILLGL 361 LIALPITLV YILLGL Sbjct: 539 LIALPITLVYYILLGL 554
>PIN3_ARATH (Q9S7Z8) Auxin efflux carrier component 3 (AtPIN3)| Length = 640 Score = 30.8 bits (68), Expect = 0.80 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 408 LIALPITLVXYILLGL 361 LIALPITLV YILLGL Sbjct: 625 LIALPITLVYYILLGL 640
>IP3KB_RAT (P42335) Inositol-trisphosphate 3-kinase B (EC 2.7.1.127) (Inositol| 1,4,5-trisphosphate 3-kinase B) (IP3K B) (IP3 3-kinase B) (IP3K-B) Length = 934 Score = 30.8 bits (68), Expect = 0.80 Identities = 22/68 (32%), Positives = 31/68 (45%), Gaps = 3/68 (4%) Frame = -1 Query: 276 FIFPPLSLSFRVSLEQQDNGGAPS*VGQWRES---VNNSQKGRGRSKCKYRAWAGGLGSQ 106 F+FPP SL ++ G A G WR +N+S G S + + G+GS Sbjct: 55 FLFPPAE-----SLSLEEPGSA----GGWRSGRRRLNSSSGSGGGSSSSNSSSSSGVGSP 105 Query: 105 NWFGFERG 82 +W G RG Sbjct: 106 SWAGRLRG 113
>PIN7_ARATH (Q940Y5) Auxin efflux carrier component 7 (AtPIN7)| Length = 619 Score = 30.8 bits (68), Expect = 0.80 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 408 LIALPITLVXYILLGL 361 LIALPITLV YILLGL Sbjct: 604 LIALPITLVYYILLGL 619
>PIN4_ARATH (Q8RWZ6) Auxin efflux carrier component 4 (AtPIN4)| Length = 616 Score = 30.8 bits (68), Expect = 0.80 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 408 LIALPITLVXYILLGL 361 LIALPITLV YILLGL Sbjct: 601 LIALPITLVYYILLGL 616
>PIN1_ORYSA (Q5SMQ9) Auxin efflux carrier component 1 (OsPIN1) (Ethylene| insensitive root 1 homolog) Length = 595 Score = 30.8 bits (68), Expect = 0.80 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 408 LIALPITLVXYILLGL 361 LIALPITLV YILLGL Sbjct: 580 LIALPITLVYYILLGL 595
>PIN1C_ORYSA (Q67UL3) Probable auxin efflux carrier component 1c (OsPIN1c)| Length = 592 Score = 30.8 bits (68), Expect = 0.80 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 408 LIALPITLVXYILLGL 361 LIALPITLV YILLGL Sbjct: 577 LIALPITLVYYILLGL 592
>PIN3B_ORYSA (Q6L5F6) Putative auxin efflux carrier component 3b (OsPIN3b)| Length = 590 Score = 30.0 bits (66), Expect = 1.4 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 408 LIALPITLVXYILLGL 361 LIALPITLV YI+LGL Sbjct: 575 LIALPITLVYYIILGL 590
>PINI_ARATH (Q9C6B8) Auxin efflux carrier component 1 (Protein PIN-FORMED)| (AtPIN1) Length = 622 Score = 29.6 bits (65), Expect = 1.8 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 408 LIALPITLVXYILLGL 361 LIALPITL+ YILLGL Sbjct: 607 LIALPITLLYYILLGL 622
>PIN3A_ORYSA (Q5VP70) Probable auxin efflux carrier component 3a (OsPIN3a)| Length = 618 Score = 29.6 bits (65), Expect = 1.8 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 408 LIALPITLVXYILLGL 361 LIALPITL+ YILLGL Sbjct: 603 LIALPITLLYYILLGL 618
>KRCL_CHICK (P25692) Claw keratin (C-ker) (cKer)| Length = 127 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = -1 Query: 123 GGLGSQNWFGFERGLRVLVGYADPC 49 GG GS + GF RG R L+G PC Sbjct: 103 GGFGSCGYGGFGRGYRSLLGSCGPC 127
>RAI1_HUMAN (Q7Z5J4) Retinoic acid-induced protein 1| Length = 1906 Score = 29.3 bits (64), Expect = 2.3 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +3 Query: 30 PERHPFYRGRRSQPKLASPFQNRTNSATPVPPPK 131 PE P R S PK A P + AT +PPP+ Sbjct: 1263 PEGSPTLFKRMSSPKKAKPTKGNGEPATKLPPPE 1296
>RC3H1_XENLA (Q6NUC6) Roquin (RING finger and C3H zinc finger protein 1)| Length = 1114 Score = 28.9 bits (63), Expect = 3.0 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = +3 Query: 6 TRQSRSVIPERH-PFYRGRRSQPKLASPFQ-NRTNSATPVP 122 T+Q ++++P ++ P Y RR+ P A P+Q A+PVP Sbjct: 657 TQQYQAIVPTQYQPHYDNRRAYPSNAPPYQREELVRASPVP 697
>KLF14_HUMAN (Q8TD94) Krueppel-like factor 14 (Transcription factor BTEB5)| (Basic transcription element-binding protein 5) (BTE-binding protein 5) Length = 323 Score = 28.9 bits (63), Expect = 3.0 Identities = 16/45 (35%), Positives = 20/45 (44%), Gaps = 7/45 (15%) Frame = +3 Query: 30 PERHPF---YRGRRSQPKLASPFQNRTNSAT----PVPPPKLCTC 143 P HP YRGRR P++ P + S+ P P P TC Sbjct: 278 PTYHPDMIEYRGRRRTPRIDPPLTSEVESSASGSGPGPAPSFTTC 322
>BMR1B_MOUSE (P36898) Bone morphogenetic protein receptor type IB precursor (EC| 2.7.11.30) (Serine/threonine-protein kinase receptor R6) (SKR6) (Activin receptor-like kinase 6) (ALK-6) Length = 502 Score = 28.9 bits (63), Expect = 3.0 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +3 Query: 105 SATPVPPPKLCTCTCFFPCPSD 170 S P P PK+ C C CP D Sbjct: 20 STAPTPRPKILRCKCHHHCPED 41
>ATG9A_RAT (Q5FWU3) Autophagy-related protein 9A (APG9-like 1)| Length = 839 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/52 (25%), Positives = 23/52 (44%) Frame = +3 Query: 9 RQSRSVIPERHPFYRGRRSQPKLASPFQNRTNSATPVPPPKLCTCTCFFPCP 164 +Q PERH ++R + ++P + + P P P+ + C P P Sbjct: 718 KQQTQAEPERHVWHRRESDESGESAPEEGGEGARAPQPIPRSASYPCATPRP 769
>ASGR2_HUMAN (P07307) Asialoglycoprotein receptor 2 (ASGP-R 2) (ASGPR 2)| (Hepatic lectin H2) Length = 311 Score = 28.5 bits (62), Expect = 4.0 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 5/43 (11%) Frame = +3 Query: 39 HPFYRG-----RRSQPKLASPFQNRTNSATPVPPPKLCTCTCF 152 HPF++G RR P+ +PF A P+ +LC+ CF Sbjct: 18 HPFHQGEGPGTRRLNPRRGNPFLKGPPPAQPL-AQRLCSMVCF 59
>BMR1B_HUMAN (O00238) Bone morphogenetic protein receptor type IB precursor (EC| 2.7.11.30) (CDw293 antigen) Length = 502 Score = 28.5 bits (62), Expect = 4.0 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +3 Query: 105 SATPVPPPKLCTCTCFFPCPSD 170 S P P PK+ C C CP D Sbjct: 20 STAPTPRPKVLRCKCHHHCPED 41
>BMR1B_CHICK (Q05438) Bone morphogenetic protein receptor type IB precursor (EC| 2.7.11.30) (Serine/threonine-protein kinase receptor R6) (SKR6) (Activin receptor-like kinase 6) (ALK-6) (RPK-1) Length = 502 Score = 28.1 bits (61), Expect = 5.2 Identities = 13/37 (35%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +3 Query: 63 SQPKLASPFQNRTNSAT-PVPPPKLCTCTCFFPCPSD 170 S KL+ + + T P PP K +C C CP D Sbjct: 5 SSSKLSMESRKEDSEGTAPAPPQKKLSCQCHHHCPED 41
>MCSP_RAT (Q64298) Sperm mitochondrial-associated cysteine-rich protein| Length = 145 Score = 28.1 bits (61), Expect = 5.2 Identities = 11/23 (47%), Positives = 11/23 (47%), Gaps = 1/23 (4%) Frame = +3 Query: 111 TPVPPPKLCTCTCFFPCP-SDCC 176 TP P P C C PCP CC Sbjct: 57 TPCPCPATCPAACACPCPMKPCC 79
>PIN2_ORYSA (Q651V6) Probable auxin efflux carrier component 2 (OsPIN2)| Length = 630 Score = 27.7 bits (60), Expect = 6.8 Identities = 11/16 (68%), Positives = 15/16 (93%) Frame = -1 Query: 408 LIALPITLVXYILLGL 361 LIALPIT++ Y+LLG+ Sbjct: 615 LIALPITILYYVLLGI 630
>PEPAF_RABIT (P27823) Pepsin F precursor (EC 3.4.23.1)| Length = 388 Score = 27.7 bits (60), Expect = 6.8 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 6/32 (18%) Frame = -1 Query: 129 WAGGLGSQNWFGF------ERGLRVLVGYADP 52 WA GL SQN F F ERG +++G DP Sbjct: 201 WAQGLISQNLFAFYLSSKEERGSMLMLGGVDP 232
>ACSA_DEIRA (Q9RRL7) Acetyl-coenzyme A synthetase (EC 6.2.1.1) (Acetate--CoA| ligase) (Acyl-activating enzyme) Length = 649 Score = 27.7 bits (60), Expect = 6.8 Identities = 14/49 (28%), Positives = 19/49 (38%) Frame = -2 Query: 176 TTVRRAGEEASASTELGRGDWGRRIGSVLKGACEFWLATPTPVKWMPFW 30 T V E A T + R ++ RR L +FW + WM W Sbjct: 15 TRVIHPSAEFQAGTRVSRAEYERRYRQSLDQPDDFWSEVAHDLHWMKDW 63
>RNFB_HAEIN (P71396) Electron transport complex protein rnfB| Length = 193 Score = 27.3 bits (59), Expect = 8.9 Identities = 14/27 (51%), Positives = 15/27 (55%), Gaps = 2/27 (7%) Frame = +3 Query: 99 TNSATPVPPPKLCT-CT-CFFPCPSDC 173 TN A P LCT C C PCP+DC Sbjct: 128 TNKAMHTIIPDLCTGCELCVAPCPTDC 154
>LPXK_PSE14 (Q48L54) Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A| 4'-kinase) Length = 331 Score = 27.3 bits (59), Expect = 8.9 Identities = 18/57 (31%), Positives = 29/57 (50%) Frame = -1 Query: 399 LPITLVXYILLGL*ARLPCKGPWLRCCGLRSSKLGVTTRGLFIFPPLSLSFRVSLEQ 229 +P+ +V I +G + P + C R ++GV +RG PP SL +RV +Q Sbjct: 51 VPVIVVGNITIGGTGKTPLILWMIEHCRRRGLRVGVVSRGYGAKPP-SLPWRVKADQ 106
>PGK_CLOTE (Q898R3) Phosphoglycerate kinase (EC 2.7.2.3)| Length = 401 Score = 27.3 bits (59), Expect = 8.9 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = -2 Query: 188 ESQSTTVRRAGEEASASTELGRGD 117 ESQ+TT+ G+ A+A +LG GD Sbjct: 348 ESQATTIIGGGDSAAAVNQLGFGD 371
>RAD5_KLULA (Q6CJM4) DNA repair protein RAD5 (EC 3.6.1.-)| Length = 1114 Score = 27.3 bits (59), Expect = 8.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -2 Query: 173 TVRRAGEEASASTELGRGDWGRRIGSV 93 T +AG E+ S++ GR W R IGS+ Sbjct: 156 TSTQAGLESPMSSDKGRNRWSRYIGSI 182
>MCSP_MOUSE (P15265) Sperm mitochondrial-associated cysteine-rich protein| Length = 143 Score = 27.3 bits (59), Expect = 8.9 Identities = 11/23 (47%), Positives = 11/23 (47%), Gaps = 2/23 (8%) Frame = +3 Query: 114 PVPPPKLCTCTCFFPCP--SDCC 176 P PPP C C PCP CC Sbjct: 53 PCPPPCPCPCPATCPCPLKPPCC 75
>GCR_RABIT (P59667) Glucocorticoid receptor (GR)| Length = 772 Score = 27.3 bits (59), Expect = 8.9 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 3/39 (7%) Frame = +3 Query: 30 PERHPFYRGRRS---QPKLASPFQNRTNSATPVPPPKLC 137 P R F G S +P ++SP N T +A PPPKLC Sbjct: 380 PGRSVFSNGYSSPGMRPDVSSPPSNSTTAAG--PPPKLC 416
>RBM4_BRARE (Q6IQ97) RNA-binding protein 4 (RNA-binding motif protein 4)| Length = 419 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +3 Query: 45 FYRGRRSQPKLASPFQNRTNSATPVPPPKLCT 140 FY R++P S F++R PVPPP T Sbjct: 306 FYEKYRARPYGGSYFEDRRAVQPPVPPPPTST 337
>PIN2_ARATH (Q9LU77) Auxin efflux carrier component 2 (AtPIN2) (Auxin efflux| carrier AGR) (Polar-auxin-transport efflux component AGRAVITROPIC 1) (AtAGR1) (Ethylene insensitive root 1) (AtEIR1) (WAVY6) Length = 647 Score = 27.3 bits (59), Expect = 8.9 Identities = 10/16 (62%), Positives = 15/16 (93%) Frame = -1 Query: 408 LIALPITLVXYILLGL 361 L+ALP+T++ Y+LLGL Sbjct: 632 LVALPVTVLYYVLLGL 647
>DOCK5_HUMAN (Q9H7D0) Dedicator of cytokinesis protein 5 (Fragment)| Length = 804 Score = 27.3 bits (59), Expect = 8.9 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +3 Query: 30 PERHPFYRGRRSQPKLASPFQNRTNSATPVPPP 128 P+ P+ +R+ +LA P R + P PPP Sbjct: 756 PKSKPYEGSQRNSTELAPPLPVRREAKAPPPPP 788 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.314 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,244,779 Number of Sequences: 219361 Number of extensions: 905553 Number of successful extensions: 1956 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 1896 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1950 length of database: 80,573,946 effective HSP length: 111 effective length of database: 56,224,875 effective search space used: 1349397000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)
