| Clone Name | rbaet69h04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PANE_SHIFL (P0A9J5) 2-dehydropantoate 2-reductase (EC 1.1.1.169)... | 28 | 8.8 | 2 | PANE_ECOLI (P0A9J4) 2-dehydropantoate 2-reductase (EC 1.1.1.169)... | 28 | 8.8 | 3 | PANE_ECO57 (Q8XE72) 2-dehydropantoate 2-reductase (EC 1.1.1.169)... | 28 | 8.8 |
|---|
>PANE_SHIFL (P0A9J5) 2-dehydropantoate 2-reductase (EC 1.1.1.169) (Ketopantoate| reductase) (KPA reductase) (KPR) Length = 303 Score = 28.1 bits (61), Expect = 8.8 Identities = 15/54 (27%), Positives = 22/54 (40%) Frame = +3 Query: 69 KASLRRRAGMTCIIKRQTNT*RHSGGHARAHPGNCMKTCTTTRAWMDLFSHRRS 230 +A L R+ + C+I T G R HP M+ C A ++ H S Sbjct: 170 RAELWRKLAVNCVINPLTAIWNCPNGELRHHPQEIMQICEEVAAVIEREGHHTS 223
>PANE_ECOLI (P0A9J4) 2-dehydropantoate 2-reductase (EC 1.1.1.169) (Ketopantoate| reductase) (KPA reductase) (KPR) Length = 303 Score = 28.1 bits (61), Expect = 8.8 Identities = 15/54 (27%), Positives = 22/54 (40%) Frame = +3 Query: 69 KASLRRRAGMTCIIKRQTNT*RHSGGHARAHPGNCMKTCTTTRAWMDLFSHRRS 230 +A L R+ + C+I T G R HP M+ C A ++ H S Sbjct: 170 RAELWRKLAVNCVINPLTAIWNCPNGELRHHPQEIMQICEEVAAVIEREGHHTS 223
>PANE_ECO57 (Q8XE72) 2-dehydropantoate 2-reductase (EC 1.1.1.169) (Ketopantoate| reductase) (KPA reductase) (KPR) Length = 303 Score = 28.1 bits (61), Expect = 8.8 Identities = 15/54 (27%), Positives = 22/54 (40%) Frame = +3 Query: 69 KASLRRRAGMTCIIKRQTNT*RHSGGHARAHPGNCMKTCTTTRAWMDLFSHRRS 230 +A L R+ + C+I T G R HP M+ C A ++ H S Sbjct: 170 RAELWRKLAVNCVINPLTAIWNCPNGELRHHPQEIMQICEEVAAVIEREGHHTS 223 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,729,123 Number of Sequences: 219361 Number of extensions: 698940 Number of successful extensions: 1566 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1532 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1566 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)