| Clone Name | rbaet69f01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y257_SYNY3 (P74415) Hypothetical UPF0079 protein sll0257 | 31 | 1.4 | 2 | SP3_MOUSE (O70494) Transcription factor Sp3 | 28 | 9.2 | 3 | NELFE_HUMAN (P18615) Negative elongation factor E (NELF-E) (RD p... | 28 | 9.2 |
|---|
>Y257_SYNY3 (P74415) Hypothetical UPF0079 protein sll0257| Length = 157 Score = 30.8 bits (68), Expect = 1.4 Identities = 18/64 (28%), Positives = 30/64 (46%), Gaps = 4/64 (6%) Frame = +2 Query: 17 LLGTCTIAQFLLLNLHARQQEELFH-DKFRVNRTYIHTFPPEYYTQGKHFPYSTCSI--- 184 + G F ++N + + L+H D +R+N + PE Y QG+ FP ++ Sbjct: 56 ITGEIVSPTFTIVNEYREGKMPLYHLDLYRLNTLEVEYLYPEQYWQGEDFPLGITAVEWP 115 Query: 185 RRLP 196 RLP Sbjct: 116 ERLP 119
>SP3_MOUSE (O70494) Transcription factor Sp3| Length = 783 Score = 28.1 bits (61), Expect = 9.2 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +3 Query: 72 SKRSFFMTSSELTGHTYTHSHQSIIHKENTFL 167 SKR FM S L H TH ++ +IH +T L Sbjct: 689 SKR--FMRSDHLAKHIKTHQNKKVIHSSSTVL 718
>NELFE_HUMAN (P18615) Negative elongation factor E (NELF-E) (RD protein)| Length = 380 Score = 28.1 bits (61), Expect = 9.2 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Frame = +1 Query: 172 NMQYKKITVLQN---DPSQGNEPTFMPFVRAIAFSSSDTELSSMTK 300 N +K+ L+ DP +G PTF PF R+I S+D +L ++ Sbjct: 83 NSGFKRSRTLEGKLKDPEKGPVPTFQPFQRSI---SADDDLQESSR 125 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,334,909 Number of Sequences: 219361 Number of extensions: 1281219 Number of successful extensions: 3436 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3361 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3436 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)