| Clone Name | rbaet69d05 |
|---|---|
| Clone Library Name | barley_pub |
>APX1_PEA (P48534) L-ascorbate peroxidase, cytosolic (EC 1.11.1.11) (AP)| Length = 249 Score = 28.5 bits (62), Expect = 4.6 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = -2 Query: 279 EAHLRLSELGYAEA 238 EAHL+LSELG+AEA Sbjct: 236 EAHLKLSELGFAEA 249
>GAM1_ORYSA (P93417) Transcription factor GAMYB (OsGAMyb)| Length = 553 Score = 28.5 bits (62), Expect = 4.6 Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = -1 Query: 100 LERCQWFGVPLY--SVCLDAINLSYEMNCSSDF 8 ++RCQ G+P+Y SVC + N + CSSDF Sbjct: 140 IKRCQRAGLPIYPTSVCNQSSN--EDQQCSSDF 170
>RNS10_SHEEP (Q70IB1) Ribonuclease-like protein 10 precursor (Protein Train A)| (Fragment) Length = 161 Score = 28.1 bits (61), Expect = 6.1 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +2 Query: 98 KVWPQANKHYYRDDYL-AVCGLTLTPSLDAEQDHP 199 +V Q+NKHY R D + C + P+L + +DHP Sbjct: 96 EVLSQSNKHYLRSDVMDRECNALMAPNLKS-KDHP 129
>LYSC_EQUAS (P11375) Lysozyme C (EC 3.2.1.17) (1,4-beta-N-acetylmuramidase C)| Length = 129 Score = 27.7 bits (60), Expect = 7.9 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +2 Query: 56 ANRVQRHTKPLTAFKVWPQANKHYYRDDYLAVCGL 160 A RV R K ++A+K W + K +YLA C L Sbjct: 95 AKRVVRDPKGMSAWKAWVKHCKDKDLSEYLASCNL 129
>LYSC1_HORSE (P11376) Lysozyme C, milk isozyme (EC 3.2.1.17)| (1,4-beta-N-acetylmuramidase C) Length = 129 Score = 27.7 bits (60), Expect = 7.9 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +2 Query: 56 ANRVQRHTKPLTAFKVWPQANKHYYRDDYLAVCGL 160 A RV R K ++A+K W + K +YLA C L Sbjct: 95 AKRVVRDPKGMSAWKAWVKHCKDKDLSEYLASCNL 129 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,475,184 Number of Sequences: 219361 Number of extensions: 545023 Number of successful extensions: 1185 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1173 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1185 length of database: 80,573,946 effective HSP length: 68 effective length of database: 65,657,398 effective search space used: 1575777552 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)