| Clone Name | rbaet69c01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MET31_YEAST (Q03081) Transcriptional regulator MET31 (Methionine... | 28 | 4.3 | 2 | FBXL8_MOUSE (Q8CIG9) F-box/LRR-repeat protein 8 (F-box and leuci... | 28 | 4.3 | 3 | YJI4_YEAST (P47029) Protein YJL084C | 28 | 5.6 | 4 | DOF1A_ARATH (Q9SEZ3) Dof zinc finger protein DOF1.10 (AtDOF1.10)... | 28 | 7.3 | 5 | PMP20_CHLPN (Q9Z812) Probable outer membrane protein pmp20 precu... | 27 | 9.5 |
|---|
>MET31_YEAST (Q03081) Transcriptional regulator MET31 (Methionine-requiring| protein 31) Length = 177 Score = 28.5 bits (62), Expect = 4.3 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +1 Query: 235 NTPTHTDPIINELRYR 282 ++PTHTDPII EL +R Sbjct: 26 SSPTHTDPIIRELLHR 41
>FBXL8_MOUSE (Q8CIG9) F-box/LRR-repeat protein 8 (F-box and leucine-rich repeat| protein 8) (F-box protein FBL8) Length = 374 Score = 28.5 bits (62), Expect = 4.3 Identities = 21/63 (33%), Positives = 24/63 (38%), Gaps = 13/63 (20%) Frame = +2 Query: 98 TVGPGTPLT-HY*SQLRTTHIRLLARP------------CTQLRDVHCAPTRRRSTTHEI 238 TVGP T HY LR +R A P C LR++HC R S Sbjct: 288 TVGPVRFATRHYAETLRALEVRASASPELHTALEELAARCAGLREIHCFCVVRPSVLDAF 347 Query: 239 RPH 247 R H Sbjct: 348 RAH 350
>YJI4_YEAST (P47029) Protein YJL084C| Length = 1046 Score = 28.1 bits (61), Expect = 5.6 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 2/68 (2%) Frame = -2 Query: 261 YWIRMCGRIS*VVDRRRVGAQCTSRSCVHGLASSRMCVVLSWLQ*CVSGVPG--PTVSDV 88 +WI++C R+S VVD +R + + S +H L R+C + L G P P +D Sbjct: 495 HWIKICLRLSRVVDNKRKHYEISIDSPIHVL--HRLCSHANTLLPSYDGHPASFPKETDS 552 Query: 87 MGSLALEA 64 S LE+ Sbjct: 553 SISSILES 560
>DOF1A_ARATH (Q9SEZ3) Dof zinc finger protein DOF1.10 (AtDOF1.10) (H-protein| promoter-binding factor 2b) Length = 399 Score = 27.7 bits (60), Expect = 7.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 134 SQLRTTHIRLLARPCTQLRDVHCAPTRRRSTTHEI 238 S+ R T I+L R T L DV+C S H++ Sbjct: 2 SKSRDTEIKLFGRTITSLLDVNCYDPSSLSPVHDV 36
>PMP20_CHLPN (Q9Z812) Probable outer membrane protein pmp20 precursor (Polymorphic| membrane protein 20) Length = 1723 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +2 Query: 44 KNKETKTASKASDPMTSLTVGPGTPLTHY 130 KN E S P T++T+GPG+ L+++ Sbjct: 1236 KNAELSVVSFTQSPGTTITMGPGSVLSNH 1264 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,793,864 Number of Sequences: 219361 Number of extensions: 848690 Number of successful extensions: 2027 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1992 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2027 length of database: 80,573,946 effective HSP length: 93 effective length of database: 60,173,373 effective search space used: 1444160952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)