| Clone Name | rbaet69b12 |
|---|---|
| Clone Library Name | barley_pub |
>GME_ARATH (Q93VR3) GDP-mannose 3,5-epimerase (EC 5.1.3.18) (GDP-Man| 3,5-epimerase) Length = 377 Score = 34.7 bits (78), Expect = 0.064 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 293 QAPVQLGSLRAADGKE 246 QAPVQLGSLRAADGKE Sbjct: 362 QAPVQLGSLRAADGKE 377
>GME1_ORYSA (Q338B5) GDP-mannose 3,5-epimerase 1 (EC 5.1.3.18) (GDP-Man| 3,5-epimerase 1) (OsGME-1) Length = 378 Score = 34.7 bits (78), Expect = 0.064 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 293 QAPVQLGSLRAADGKE 246 QAPVQLGSLRAADGKE Sbjct: 363 QAPVQLGSLRAADGKE 378
>GME2_ORYSA (Q2R1V8) GDP-mannose 3,5-epimerase 2 (EC 5.1.3.18) (GDP-Man| 3,5-epimerase 2) Length = 371 Score = 34.7 bits (78), Expect = 0.064 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 293 QAPVQLGSLRAADGKE 246 QAPVQLGSLRAADGKE Sbjct: 356 QAPVQLGSLRAADGKE 371
>GFRA3_MOUSE (O35118) GDNF family receptor alpha-3 precursor (GFR-alpha-3)| Length = 397 Score = 31.6 bits (70), Expect = 0.54 Identities = 17/51 (33%), Positives = 21/51 (41%) Frame = -1 Query: 203 PNCPPIGSFVAKTLENCTACPAYPMCDSADSSAPVHCHPH*LLSSCQQNSS 51 PNC + SF C A P+C S HCHP +L +C S Sbjct: 243 PNCLDLRSF----------CRADPLCRSRLMDFQTHCHPMDILGTCATEQS 283
>GFRA3_HUMAN (O60609) GDNF family receptor alpha-3 precursor (GFR-alpha-3)| Length = 400 Score = 30.8 bits (68), Expect = 0.92 Identities = 18/53 (33%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = -1 Query: 203 PNC--PPIGSFVAKTLENCTACPAYPMCDSADSSAPVHCHPH*LLSSCQQNSS 51 PNC PP+ LE C + P+C S HCHP +L +C S Sbjct: 237 PNCALPPVAP---NCLELRRLCFSDPLCRSRLVDFQTHCHPMDILGTCATEQS 286
>ALCR_EMENI (P21228) Regulatory protein alcR| Length = 821 Score = 30.4 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = -2 Query: 181 PSLRKHLRIAQPALPTPCVIQQILVLLFIVTPIN--YYHRVNRI 56 P H +I+QPA PC +Q L TP+ Y RV ++ Sbjct: 566 PDHESHTQISQPAARWPCTYEQAAAALSSATPVKVLLYRRVTQL 609
>EMR1_MOUSE (Q61549) EGF-like module-containing mucin-like hormone| receptor-like 1 precursor (Cell surface glycoprotein EMR1) (EMR1 hormone receptor) (Cell surface glycoprotein F4/80) Length = 931 Score = 29.3 bits (64), Expect = 2.7 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +3 Query: 126 THGVGRAGCAILKCFRNEGSDRWAIGQWHNRPGVDMHSCLLLAV 257 T+ +GRA C+ L+ F + W +G N D+ CL + + Sbjct: 99 TNILGRAKCSCLRGFSSSTGKDWILGSLDNFLCADVDECLTIGI 142
>NOTC1_BRARE (P46530) Neurogenic locus notch homolog protein 1 precursor| Length = 2437 Score = 28.5 bits (62), Expect = 4.6 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = -2 Query: 289 HRCSWAPSARLTARSKQLCISTPG-LLCHCPIAHRSDPSLRKHLRIAQPALPTPC 128 + C+ +PS R+ CI+ G LC CP + + P + R+ QP LP+PC Sbjct: 179 NECAVSPSP---CRNGGTCINEVGSYLCRCPPEY-TGPHCQ---RLYQPCLPSPC 226
>RSPO1_MOUSE (Q9Z132) R-spondin-1 precursor (Roof plate-specific spondin-1)| (Cysteine-rich and single thrombospondin domain-containing protein 3) (Cristin-3) (mCristin-3) Length = 265 Score = 28.1 bits (61), Expect = 6.0 Identities = 19/73 (26%), Positives = 32/73 (43%), Gaps = 13/73 (17%) Frame = -1 Query: 206 LPNCPPIGSFVAKT----------LENCTACPAYPMCDSADSSAPVH---CHPH*LLSSC 66 LP+CPP G F A+ +E+C AC ++ C + +H C+P +C Sbjct: 76 LPSCPP-GYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCQEALYLHKGRCYP-----AC 129 Query: 65 QQNSSYITLLIGC 27 + S+ + C Sbjct: 130 PEGSTAANSTMEC 142
>RSPO1_HUMAN (Q2MKA7) R-spondin-1 precursor (Roof plate-specific spondin-1)| (hRspo1) Length = 263 Score = 28.1 bits (61), Expect = 6.0 Identities = 20/74 (27%), Positives = 32/74 (43%), Gaps = 13/74 (17%) Frame = -1 Query: 206 LPNCPPIGSFVAKT----------LENCTACPAYPMCDSADSSAPVH---CHPH*LLSSC 66 LP+CPP G F A+ +E+C AC ++ C +H C+P +C Sbjct: 76 LPSCPP-GYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYP-----AC 129 Query: 65 QQNSSYITLLIGCT 24 + SS + C+ Sbjct: 130 PEGSSAANGTMECS 143 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,625,914 Number of Sequences: 219361 Number of extensions: 787608 Number of successful extensions: 2410 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2316 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2406 length of database: 80,573,946 effective HSP length: 73 effective length of database: 64,560,593 effective search space used: 1549454232 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)