| Clone Name | rbaet68h02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RR7_ASTLO (P14760) Plastid 30S ribosomal protein S7 | 31 | 1.3 | 2 | HES3_MOUSE (Q61657) Transcription factor HES-3 (Hairy and enhanc... | 30 | 3.7 | 3 | PGLR1_ASPNG (P26213) Polygalacturonase-1 precursor (EC 3.2.1.15)... | 29 | 4.8 | 4 | CP007_HUMAN (Q9Y2B5) Protein C16orf7 (Protein ATP-BL) | 28 | 8.2 |
|---|
>RR7_ASTLO (P14760) Plastid 30S ribosomal protein S7| Length = 178 Score = 31.2 bits (69), Expect = 1.3 Identities = 14/44 (31%), Positives = 28/44 (63%) Frame = +2 Query: 38 VHL*IKMQRQGQLNTIFV*TKLETRRESPSKDLLKSSKRQKNKN 169 + L + +++GQ++ I + TKLE R + K ++ S+K++ KN Sbjct: 73 IELRTQKRKKGQISKISIKTKLERRNKIALKFIINSAKKRSEKN 116
>HES3_MOUSE (Q61657) Transcription factor HES-3 (Hairy and enhancer of split 3)| Length = 175 Score = 29.6 bits (65), Expect = 3.7 Identities = 17/64 (26%), Positives = 27/64 (42%) Frame = +3 Query: 225 SNFRGKRRAAAVQVTPFSSDGEKTCPFQEQQEKQPSYSSTSNHLLGLVEVRRAVVLAPSD 404 S F G R + ++ P D CP Q+ + + S + ++ + APS Sbjct: 67 SGFHGGLRGVSQRLRPGEGDSGLRCPLLLQRREGSTTDSANPQATSVLNPCLPAIWAPSR 126 Query: 405 AAGG 416 AAGG Sbjct: 127 AAGG 130
>PGLR1_ASPNG (P26213) Polygalacturonase-1 precursor (EC 3.2.1.15)| (Polygalacturonase I) (PG-I) (Pectinase 1) Length = 368 Score = 29.3 bits (64), Expect = 4.8 Identities = 17/41 (41%), Positives = 20/41 (48%) Frame = +3 Query: 294 TCPFQEQQEKQPSYSSTSNHLLGLVEVRRAVVLAPSDAAGG 416 TC F E S SS S+ +L +EV L SDAA G Sbjct: 34 TCTFTSASEASESISSCSDVVLSSIEVPAGETLDLSDAADG 74
>CP007_HUMAN (Q9Y2B5) Protein C16orf7 (Protein ATP-BL)| Length = 438 Score = 28.5 bits (62), Expect = 8.2 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 9/30 (30%) Frame = +1 Query: 379 GRWSLPHP--TPRVD-------SRYWSTRW 441 G W LPHP TP +D SR WS+ W Sbjct: 389 GPWGLPHPWGTPHLDCQTRTARSRTWSSSW 418 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,691,716 Number of Sequences: 219361 Number of extensions: 914856 Number of successful extensions: 2605 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2551 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2604 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)