| Clone Name | rbaet68g08 |
|---|---|
| Clone Library Name | barley_pub |
>14KD_DAUCA (P14009) 14 kDa proline-rich protein DC2.15 precursor| Length = 137 Score = 55.8 bits (133), Expect = 5e-08 Identities = 23/36 (63%), Positives = 29/36 (80%) Frame = -1 Query: 455 CTALKANVLGIVLNIPVKLSLLLNYCGKTAPKGFQC 348 CTA+KAN+LG LN+P+ LSL+LN CGK P GF+C Sbjct: 101 CTAIKANILGKNLNLPIALSLVLNNCGKQVPNGFEC 136
>CCDP_MAIZE (Q01595) Cortical cell-delineating protein precursor (Root-specific| protein ZRP3) Length = 129 Score = 52.0 bits (123), Expect = 7e-07 Identities = 21/36 (58%), Positives = 28/36 (77%) Frame = -1 Query: 455 CTALKANVLGIVLNIPVKLSLLLNYCGKTAPKGFQC 348 CTA+KANVLGI LN+P+ L+ +LN CG+ P+ F C Sbjct: 92 CTAIKANVLGIHLNVPLSLNFILNNCGRICPEDFTC 127
>PRF1_LYCES (Q00451) 36.4 kDa proline-rich protein| Length = 346 Score = 37.7 bits (86), Expect = 0.014 Identities = 14/36 (38%), Positives = 24/36 (66%) Frame = -1 Query: 455 CTALKANVLGIVLNIPVKLSLLLNYCGKTAPKGFQC 348 CT ++ +L I + +P+ L +L++ CGK PK F+C Sbjct: 308 CTTIRLKLLNINIILPIALQVLIDDCGKYPPKDFKC 343
>HPSE_SOYBN (P24337) Hydrophobic seed protein (HPS) (Allergen Gly m 1)| Length = 80 Score = 30.0 bits (66), Expect = 2.9 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -1 Query: 455 CTALKANVLGIVLNIPVKLSLLLNYCGKTAPKGFQC 348 C ++ LGI LN+ L L+LN CG++ P C Sbjct: 43 CLCIQLRALGI-LNLNRNLQLILNSCGRSYPSNATC 77
>O2T11_HUMAN (Q8NH01) Olfactory receptor 2T11 (Olfactory receptor OR1-65)| Length = 316 Score = 29.6 bits (65), Expect = 3.8 Identities = 21/72 (29%), Positives = 31/72 (43%) Frame = -1 Query: 425 IVLNIPVKLSLLLNYCGKTAPKGFQCA*IHLPLNQSKACMHASPVHASMHVCCYLL*SFI 246 I +N+P YCG + F C +P AC S M++CC L+ I Sbjct: 159 ITMNVP--------YCGSRSINHFFC---EIPAVLKLACADTSLYETLMYICCVLM-LLI 206 Query: 245 PNLISSCNRSVV 210 P I S + S++ Sbjct: 207 PISIISTSYSLI 218
>PALI_EMENI (O93956) pH-response regulator protein palI/RIM9| Length = 549 Score = 29.3 bits (64), Expect = 4.9 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 4/60 (6%) Frame = +1 Query: 37 KQIQVLHMLNQ----TTVEAHTRTQSYVSLVRSTQPN*DKLMSPN*PVHINEHTHARTKN 204 +Q+ + + NQ + ++RTQSYV R+ P + PN P N+ HAR+++ Sbjct: 454 QQLHAISIDNQHEPVSPTSLYSRTQSYVPPRRNWGPQAYQSSEPNLPYQPNQPRHARSQS 513 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,264,949 Number of Sequences: 219361 Number of extensions: 1015674 Number of successful extensions: 2098 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2033 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2096 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)