| Clone Name | rbaet68e05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | E75BB_DROME (P13055) Ecdysone-induced protein 75B isoform B (E75-C) | 31 | 1.3 | 2 | MOT3_YEAST (P54785) Transcriptional activator/repressor MOT3 (Mo... | 31 | 1.7 | 3 | RL4_METAC (Q8TRU6) 50S ribosomal protein L4P | 30 | 2.2 | 4 | RL4_METMA (Q8PV49) 50S ribosomal protein L4P | 30 | 2.8 | 5 | SERC_VIBCH (Q9KSU7) Phosphoserine aminotransferase (EC 2.6.1.52)... | 28 | 8.2 |
|---|
>E75BB_DROME (P13055) Ecdysone-induced protein 75B isoform B (E75-C)| Length = 1412 Score = 31.2 bits (69), Expect = 1.3 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +3 Query: 42 HKTVVASQHVQEPRSRPDSHTHKVNKQQSRAHQTH 146 H V+AS H Q+ + + + H+ QQ + HQ H Sbjct: 313 HVNVIASNHFQQQQQQHQAQQHQQQHQQHQQHQQH 347
>MOT3_YEAST (P54785) Transcriptional activator/repressor MOT3 (Modulator of| transcription protein 3) (Hypoxic gene repressor protein 7) Length = 490 Score = 30.8 bits (68), Expect = 1.7 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 5/51 (9%) Frame = +3 Query: 57 ASQHVQEPRSRPDSHTHKVNKQQSRAH----QTHTRIQR-ANTDDVGTASL 194 A H+Q+ + + H + ++QQ H Q HT +Q +NT+++G+ SL Sbjct: 3 ADHHLQQQQQQRQQHQQQQHQQQQHQHQHQQQQHTILQNVSNTNNIGSDSL 53
>RL4_METAC (Q8TRU6) 50S ribosomal protein L4P| Length = 253 Score = 30.4 bits (67), Expect = 2.2 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +2 Query: 89 ARQPHAQGKQTAITCTPNAYKNTKSKYRRRRHGVPTACAVTS 214 AR PHA+G + A P A ++ K + RR+ + +A A T+ Sbjct: 81 ARVPHAKGGRRAHPPKPEADRSEKVNTKERRYAIRSAIAATT 122
>RL4_METMA (Q8PV49) 50S ribosomal protein L4P| Length = 253 Score = 30.0 bits (66), Expect = 2.8 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +2 Query: 89 ARQPHAQGKQTAITCTPNAYKNTKSKYRRRRHGVPTACAVT 211 AR PHA+G + A P A ++ K + RR+ + +A A T Sbjct: 81 ARVPHAKGGRRAHPPKPEADRSEKVNTKERRYAIRSAIAAT 121
>SERC_VIBCH (Q9KSU7) Phosphoserine aminotransferase (EC 2.6.1.52) (PSAT)| Length = 364 Score = 28.5 bits (62), Expect = 8.2 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = -1 Query: 451 CAALVKNGVLDVKHNCIPGFANQRGPAECVSFLSQPKT 338 C A+V++ +LD+ + +PG N + AE S + P T Sbjct: 208 CIAIVRDDLLDLASDLLPGVLNYKILAEQESMFNTPPT 245 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,076,475 Number of Sequences: 219361 Number of extensions: 795771 Number of successful extensions: 2673 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2598 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2673 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)