| Clone Name | rbaet68c09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SURF4_CAEEL (Q18864) Surfeit locus protein 4 homolog | 27 | 9.9 |
|---|
>SURF4_CAEEL (Q18864) Surfeit locus protein 4 homolog| Length = 277 Score = 27.3 bits (59), Expect = 9.9 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = -3 Query: 173 LDEEFSSPMLTTTITIFYNLF---LPVINYVLLYKVAVLCSGVLPRVV 39 + E +S T+ + YN F +PV+ +L KV V C G+L +V Sbjct: 62 MQESWSCGWFIATLFVIYNFFGQFIPVLMIMLRKKVLVAC-GILASIV 108 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,732,949 Number of Sequences: 219361 Number of extensions: 499876 Number of successful extensions: 936 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 935 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 936 length of database: 80,573,946 effective HSP length: 80 effective length of database: 63,025,066 effective search space used: 1512601584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)