| Clone Name | rbaet67g05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CNGC1_ARATH (O65717) Cyclic nucleotide-gated ion channel 1 (AtCN... | 34 | 0.19 | 2 | ORYZ_ASPFL (P35211) Oryzin precursor (EC 3.4.21.63) (Alkaline pr... | 29 | 6.2 | 3 | PTG3B_CORGL (Q45298) PTS system glucose-specific EIIBCA componen... | 28 | 8.1 |
|---|
>CNGC1_ARATH (O65717) Cyclic nucleotide-gated ion channel 1 (AtCNGC1) (Cyclic| nucleotide-and calmodulin-regulated ion channel 1) Length = 716 Score = 33.9 bits (76), Expect = 0.19 Identities = 13/23 (56%), Positives = 20/23 (86%) Frame = -3 Query: 446 RLQERVPARLLQKPAEPNFSAEE 378 R+ ER+P LLQKPAEP+F++++ Sbjct: 694 RMPERMPPMLLQKPAEPDFNSDD 716
>ORYZ_ASPFL (P35211) Oryzin precursor (EC 3.4.21.63) (Alkaline proteinase)| (ALP) (Elastase) (Elastinolytic serine proteinase) Length = 403 Score = 28.9 bits (63), Expect = 6.2 Identities = 17/57 (29%), Positives = 27/57 (47%) Frame = +3 Query: 168 IHKTRSLITSHHCLVLLSRPGSNISSLNRYATAIPWLAFEPLANTVSNISDATAQIV 338 ++ TR+ +++ +V + PG NI S W+ NT+S S AT IV Sbjct: 308 VNNTRAYFSNYGSVVDIFAPGQNILSA--------WIGSNTATNTISGTSMATPHIV 356
>PTG3B_CORGL (Q45298) PTS system glucose-specific EIIBCA component (EIIBCA-Glc)| (EII-Glc/EIII-Glc) [Includes: Glucose-specific phosphotransferase enzyme IIB component (EC 2.7.1.69) (PTS system glucose-specific EIIB component); Glucose permease IIC compone Length = 674 Score = 28.5 bits (62), Expect = 8.1 Identities = 18/40 (45%), Positives = 22/40 (55%) Frame = +3 Query: 270 PWLAFEPLANTVSNISDATAQIVQKITLSRHSCKLLLLCG 389 P +A EP NTV +DAT +VQK S H+ L L G Sbjct: 552 PGIAIEPTGNTVVAPADATVILVQK---SGHAVALRLESG 588 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,544,695 Number of Sequences: 219361 Number of extensions: 1305359 Number of successful extensions: 4244 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4011 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4244 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)