| Clone Name | rbaet67f02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | METK_TROWT (Q83GE4) S-adenosylmethionine synthetase (EC 2.5.1.6)... | 28 | 8.7 | 2 | METK_TROW8 (Q83HT7) S-adenosylmethionine synthetase (EC 2.5.1.6)... | 28 | 8.7 |
|---|
>METK_TROWT (Q83GE4) S-adenosylmethionine synthetase (EC 2.5.1.6) (Methionine| adenosyltransferase) (AdoMet synthetase) (MAT) Length = 395 Score = 28.5 bits (62), Expect = 8.7 Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 11/58 (18%) Frame = -2 Query: 302 RGGEET-DGRGCA---GEISQ-------GVLRKPSLLLSRTSPDAGLEDGICSHQSQL 162 R G ET G G GE+S G++RK L + TS DAG++ CS Q + Sbjct: 36 RAGIETIAGNGVVHVFGEVSNPDSVDIPGIIRKTILDIGYTSEDAGIDGNTCSIQESI 93
>METK_TROW8 (Q83HT7) S-adenosylmethionine synthetase (EC 2.5.1.6) (Methionine| adenosyltransferase) (AdoMet synthetase) (MAT) Length = 395 Score = 28.5 bits (62), Expect = 8.7 Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 11/58 (18%) Frame = -2 Query: 302 RGGEET-DGRGCA---GEISQ-------GVLRKPSLLLSRTSPDAGLEDGICSHQSQL 162 R G ET G G GE+S G++RK L + TS DAG++ CS Q + Sbjct: 36 RAGIETIAGNGVVHVFGEVSNPDSVDIPGIIRKTILDIGYTSEDAGIDGNTCSIQESI 93 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,524,769 Number of Sequences: 219361 Number of extensions: 666759 Number of successful extensions: 1372 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1361 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1372 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)