| Clone Name | rbaet67f01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EPB42_MOUSE (P49222) Erythrocyte membrane protein band 4.2 (Eryt... | 30 | 3.8 | 2 | FLNB_MOUSE (Q80X90) Filamin-B (FLN-B) (Beta-filamin) (Actin-bind... | 28 | 8.6 | 3 | JAG1B_BRARE (Q90Y54) Jagged-1b precursor (Jagged1b) (Jagged3) | 28 | 8.6 | 4 | HIRL_SCHPO (P87314) Histone transcription regulator 1 homolog | 28 | 8.6 |
|---|
>EPB42_MOUSE (P49222) Erythrocyte membrane protein band 4.2 (Erythrocyte protein| 4.2) (P4.2) Length = 690 Score = 29.6 bits (65), Expect = 3.8 Identities = 23/74 (31%), Positives = 34/74 (45%), Gaps = 6/74 (8%) Frame = +3 Query: 252 GWKLLHAGASPGA------ALVS*LCTRETVLKLSSSSPAISYPARKKSRVPTTAMVWYS 413 GW++LH A GA +LV +E L+L + P + + V + +VW Sbjct: 344 GWQILHPRAPNGAGVLGSCSLVPVRAVKEGELQLDPAVPELF------AAVNASCVVW-K 396 Query: 414 CCADGGRLLASSAR 455 CC DG L +S R Sbjct: 397 CCEDGKLELTNSNR 410
>FLNB_MOUSE (Q80X90) Filamin-B (FLN-B) (Beta-filamin) (Actin-binding-like| protein) (ABP-280-like protein) Length = 2602 Score = 28.5 bits (62), Expect = 8.6 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -1 Query: 295 SAAPGLAPAWSSFQPKMDHDN 233 S APGL P W S+ P+ DN Sbjct: 177 SCAPGLCPDWESWDPRKPVDN 197
>JAG1B_BRARE (Q90Y54) Jagged-1b precursor (Jagged1b) (Jagged3)| Length = 1213 Score = 28.5 bits (62), Expect = 8.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +1 Query: 403 CGIAAAPTAGGCWPAAPGP 459 C + P+ G CWP+AP P Sbjct: 922 CFVKPCPSLGECWPSAPPP 940
>HIRL_SCHPO (P87314) Histone transcription regulator 1 homolog| Length = 932 Score = 28.5 bits (62), Expect = 8.6 Identities = 21/72 (29%), Positives = 30/72 (41%), Gaps = 10/72 (13%) Frame = -1 Query: 406 HTMAVVGTRLFFLAGYEIAGDDDESFRTVSLVHSYDTSAAPGLAPA----------WSSF 257 HT V R Y +G DD R V + H + A PGL W S+ Sbjct: 73 HTGTVTSVRFSPNGQYLASGSDD---RVVIIWHKEE--AIPGLGSTFGSGEKHTENWRSY 127 Query: 256 QPKMDHDNNVED 221 + + HDN+++D Sbjct: 128 RRLLGHDNDIQD 139 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,081,497 Number of Sequences: 219361 Number of extensions: 829056 Number of successful extensions: 2323 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2267 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2323 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)