| Clone Name | rbaet67e07 |
|---|---|
| Clone Library Name | barley_pub |
>CRD1_HORVU (Q5EFU4) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) (Protein Xantha-l) Length = 417 Score = 97.8 bits (242), Expect = 6e-21 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -3 Query: 379 ESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 233 ESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY Sbjct: 369 ESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 417
>CRD1_GOSHI (Q6SJV8) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 405 Score = 85.1 bits (209), Expect = 4e-17 Identities = 39/49 (79%), Positives = 46/49 (93%) Frame = -3 Query: 379 ESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 233 E++D+PLVKNLKR+PLIA L SE++A YLMPPIESGSVDFAEFEP+LVY Sbjct: 357 ETSDIPLVKNLKRIPLIAALASELLATYLMPPIESGSVDFAEFEPQLVY 405
>CRD1_EUPES (Q945B7) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 405 Score = 84.3 bits (207), Expect = 6e-17 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = -3 Query: 379 ESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 233 E+ D +VKNLKRVPLIA LVSEI+AAYLMPPIESGSVDFAEFEPKLVY Sbjct: 357 ETEDNSVVKNLKRVPLIAALVSEILAAYLMPPIESGSVDFAEFEPKLVY 405
>CRD1_ARATH (Q9M591) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) (Copper response defect 1 protein) (Dicarboxylate diiron protein) (AtZIP Length = 409 Score = 76.6 bits (187), Expect = 1e-14 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = -3 Query: 379 ESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 233 E++D +K LKR+PL+ L SEI+AAYLMPP+ESGSVDFAEFEP LVY Sbjct: 361 ETDDASFIKTLKRIPLVTSLASEILAAYLMPPVESGSVDFAEFEPNLVY 409
>CTH1_CHLRE (Q9AR22) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase 2, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase 2) (Copper target homolog 1 protein) Length = 407 Score = 35.0 bits (79), Expect = 0.044 Identities = 14/42 (33%), Positives = 26/42 (61%) Frame = -3 Query: 358 VKNLKRVPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 233 +K + + P++ ++V+E+ ++M P ESGS D + LVY Sbjct: 366 IKAIMKAPILERMVAEVFQVFIMTPKESGSYDLDANKTALVY 407
>ACSF_PORPU (P51277) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 349 Score = 31.6 bits (70), Expect = 0.49 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = -3 Query: 364 PLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSV 266 PLVK + PL L+ +I YL+ PI+S +V Sbjct: 312 PLVKTFMKAPLYMSLILNLIKIYLIKPIDSQAV 344
>ACSF1_ANASP (Q8YX57) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase 1 (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase 1) Length = 351 Score = 28.9 bits (63), Expect = 3.2 Identities = 12/34 (35%), Positives = 23/34 (67%) Frame = -3 Query: 376 SNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIES 275 S+ VK ++++PLIA +V ++ YL+ PI++ Sbjct: 310 SSQPKFVKLIRKLPLIAAIVWNLLMVYLIKPIDT 343
>LTBP3_MOUSE (Q61810) Latent transforming growth factor beta-binding protein 3| precursor (LTBP-3) Length = 1268 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = -2 Query: 227 LSKKDSSLPIFTNIMMHHAPRESLNEHRVHG*LT*STSSCAHL 99 +S + + P N+ +HH P S+ HR+ G +S HL Sbjct: 214 ISAEVQAPPPVVNVRVHHPPEASVQVHRIEGPNAEGPASSQHL 256
>SYG_TREDE (Q73RR5) Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine--tRNA| ligase) (GlyRS) Length = 451 Score = 28.1 bits (61), Expect = 5.4 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 190 FVKIGRDESFFDKFSKQAWA 249 FVK G D+ +FD + KQ WA Sbjct: 206 FVKPGTDDEWFDYWKKQRWA 225
>PDZK3_RAT (Q9QZR8) PDZ domain-containing protein 3 (PDZ domain-containing| protein 2) (Plakophilin-related armadillo repeat protein-interacting PDZ protein) Length = 2766 Score = 28.1 bits (61), Expect = 5.4 Identities = 17/56 (30%), Positives = 22/56 (39%) Frame = -1 Query: 306 SLRTSCPQSSLAPLILPNLSPSLFTEFVEKGFISAYLYKHNDASCSSRVSK*AQGP 139 SLRTS +S+ P SP L E +Y +D SC + GP Sbjct: 1883 SLRTSASDTSIRTFTSPLTSPKLLPEQGANSRFHMAVYLESDTSCPTTSRSPRSGP 1938
>YJCN_BACSU (O31636) Hypothetical protein yjcN precursor| Length = 106 Score = 27.7 bits (60), Expect = 7.0 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -1 Query: 267 LILPNLSPSLFTEFVEKGFISAYLYK 190 ++LP LSP +FT EKG I +YK Sbjct: 20 IVLPVLSPVVFTASSEKGAIRHEIYK 45 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,578,980 Number of Sequences: 219361 Number of extensions: 1008772 Number of successful extensions: 2131 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2099 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2131 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 1396778976 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)