| Clone Name | rbaet67d12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LOX21_HORVU (P93184) Lipoxygenase 2.1, chloroplast precursor (EC... | 60 | 1e-09 | 2 | LOX22_HORVU (Q8GSM3) Lipoxygenase 2.2, chloroplast precursor (EC... | 52 | 5e-07 | 3 | LOX4_ORYSA (Q53RB0) Probable lipoxygenase 4 (EC 1.13.11.12) | 33 | 0.19 | 4 | ACDE2_METTE (Q9C4Z3) Acetyl-CoA decarbonylase/synthase complex e... | 28 | 8.1 |
|---|
>LOX21_HORVU (P93184) Lipoxygenase 2.1, chloroplast precursor (EC 1.13.11.12)| (LOX-100) (LOX2:Hv:1) Length = 936 Score = 60.1 bits (144), Expect = 1e-09 Identities = 31/36 (86%), Positives = 31/36 (86%), Gaps = 5/36 (13%) Frame = -1 Query: 256 MVPYVLLRPSDGDPTD-----EKMVMEMGIPNSISI 164 MVPYVLLRPSDGDPTD EKMVMEMGIPNSISI Sbjct: 901 MVPYVLLRPSDGDPTDGDPTDEKMVMEMGIPNSISI 936
>LOX22_HORVU (Q8GSM3) Lipoxygenase 2.2, chloroplast precursor (EC 1.13.11.12)| (LOX2:Hv:2) Length = 932 Score = 51.6 bits (122), Expect = 5e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -1 Query: 256 MVPYVLLRPSDGDPTDEKMVMEMGIPNSISI 164 +VPYVLLRP +G+P D K VMEMGIPNSISI Sbjct: 902 VVPYVLLRPLNGNPMDAKTVMEMGIPNSISI 932
>LOX4_ORYSA (Q53RB0) Probable lipoxygenase 4 (EC 1.13.11.12)| Length = 877 Score = 33.1 bits (74), Expect = 0.19 Identities = 18/32 (56%), Positives = 22/32 (68%), Gaps = 2/32 (6%) Frame = -1 Query: 253 VPYVLLRPSDGDPTDEKM--VMEMGIPNSISI 164 +PY+LL P+ D T EK + MGIPNSISI Sbjct: 846 MPYMLLYPNTSDVTKEKGQGLTAMGIPNSISI 877
>ACDE2_METTE (Q9C4Z3) Acetyl-CoA decarbonylase/synthase complex epsilon subunit| 2 (ACDS complex epsilon subunit 2) Length = 170 Score = 27.7 bits (60), Expect = 8.1 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -1 Query: 100 WPGGGYNGNEPQIIIKGHDDIYI 32 WPG NGN II+ GH YI Sbjct: 99 WPGLDGNGNYDTIILLGHKKYYI 121 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,639,443 Number of Sequences: 219361 Number of extensions: 776188 Number of successful extensions: 1881 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1806 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1872 length of database: 80,573,946 effective HSP length: 60 effective length of database: 67,412,286 effective search space used: 1617894864 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)