| Clone Name | rbaet67d03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PYRF_PROMP (Q7V0D8) Orotidine 5'-phosphate decarboxylase (EC 4.1... | 28 | 7.7 |
|---|
>PYRF_PROMP (Q7V0D8) Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP| decarboxylase) (OMPDCase) (OMPdecase) Length = 239 Score = 27.7 bits (60), Expect = 7.7 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = +2 Query: 140 TATTPAQINQSSNLNQRHCMQLHANPLACTYPRGCGDVSRLIISTCMVHAPA 295 T P+ I NLN++ + L + + T C +VS+L + VHA A Sbjct: 43 TREGPSVIKILKNLNKKIFLDLKFHDIPNTMSAACYEVSKLGVDIISVHASA 94 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,498,457 Number of Sequences: 219361 Number of extensions: 591235 Number of successful extensions: 1282 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1266 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1282 length of database: 80,573,946 effective HSP length: 76 effective length of database: 63,902,510 effective search space used: 1533660240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)