| Clone Name | rbaet67a01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CCPR_YARLI (Q6C0Z6) Cytochrome c peroxidase, mitochondrial precu... | 30 | 2.2 | 2 | CBIO1_MYCMS (Q6MSQ2) Cobalt import ATP-binding protein cbiO 1 | 29 | 2.9 | 3 | CBIO2_MESFL (Q6F1W4) Cobalt import ATP-binding protein cbiO 2 | 28 | 5.0 |
|---|
>CCPR_YARLI (Q6C0Z6) Cytochrome c peroxidase, mitochondrial precursor (EC| 1.11.1.5) (CCP) Length = 340 Score = 29.6 bits (65), Expect = 2.2 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +1 Query: 115 PDLVEPITHVVSLVTNQTFNNQQHVALYGTRLL 213 PD + THV ++ Q FN+Q+ VAL G L Sbjct: 194 PDASQGATHVRNVFNRQGFNDQEMVALIGAHAL 226
>CBIO1_MYCMS (Q6MSQ2) Cobalt import ATP-binding protein cbiO 1| Length = 303 Score = 29.3 bits (64), Expect = 2.9 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = -2 Query: 161 FVTRETTCVIGSTRSGVST--EFTSGLCVS 78 F + TCVIG+T SG ST + T+GL +S Sbjct: 48 FKKNKVTCVIGTTGSGKSTMIQLTNGLIIS 77
>CBIO2_MESFL (Q6F1W4) Cobalt import ATP-binding protein cbiO 2| Length = 315 Score = 28.5 bits (62), Expect = 5.0 Identities = 14/27 (51%), Positives = 20/27 (74%), Gaps = 2/27 (7%) Frame = -2 Query: 152 RETTCVIGSTRSGVST--EFTSGLCVS 78 ++ TCVIG+T SG ST + T+GL +S Sbjct: 61 KKITCVIGTTGSGKSTMIQLTNGLLIS 87 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.131 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,033,915 Number of Sequences: 219361 Number of extensions: 470409 Number of successful extensions: 1006 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1003 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1006 length of database: 80,573,946 effective HSP length: 47 effective length of database: 70,263,979 effective search space used: 1686335496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)