| Clone Name | rbaet66f06 |
|---|---|
| Clone Library Name | barley_pub |
>CCNL2_XENTR (Q5BKF8) Cyclin-L2| Length = 497 Score = 31.6 bits (70), Expect = 0.89 Identities = 17/36 (47%), Positives = 23/36 (63%) Frame = -3 Query: 435 NRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSP 328 +RSQSP + Q+ +PS S+S SPSR +S SP Sbjct: 377 SRSQSPKRRKSQSYSPSS---DSKSRSPSRSRSDSP 409
>H6ST2_MOUSE (Q80UW0) Heparan-sulfate 6-O-sulfotransferase 2 (EC 2.8.2.-)| (HS6ST-2) (mHS6ST-2) (Fragment) Length = 538 Score = 31.6 bits (70), Expect = 0.89 Identities = 15/44 (34%), Positives = 29/44 (65%) Frame = -3 Query: 435 NRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQNQ 304 ++SQSP + QN NP+ ++ +++LS + S +P+ TQ +N+ Sbjct: 464 SQSQSPGQNLSQNPNPNPNQNLTQNLSHNLTPSSNPNSTQRENR 507
>SRBS1_MOUSE (Q62417) Sorbin and SH3 domain-containing protein 1 (Ponsin)| (c-Cbl-associated protein) (CAP) (SH3 domain protein 5) (SH3P12) Length = 1290 Score = 31.2 bits (69), Expect = 1.2 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = -3 Query: 423 SPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQNQ 304 S +PSR ++P Q + Q R ++P R Q PSL C Q Sbjct: 1199 SSSPSRSATVSPQQPQAQQRRVTPDRSQ---PSLDLCSYQ 1235
>SFR16_MOUSE (Q8CFC7) Splicing factor, arginine/serine-rich 16 (Suppressor of| white-apricot homolog 2) (Clk4-associating SR-related protein) Length = 653 Score = 30.8 bits (68), Expect = 1.5 Identities = 18/35 (51%), Positives = 23/35 (65%) Frame = -3 Query: 429 SQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 325 S S +PSR +++ S SR QSRS S S+ SQS S Sbjct: 476 SWSLSPSRSRSVTRSGSRSQSRSRSRSQSHSQSQS 510 Score = 28.5 bits (62), Expect = 7.6 Identities = 17/35 (48%), Positives = 22/35 (62%) Frame = -3 Query: 429 SQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 325 S SP+ SR + S+S+ +SRS S S QSQS S Sbjct: 478 SLSPSRSRSVTRSGSRSQSRSRSRSQSHSQSQSHS 512
>SFRS4_MOUSE (Q8VE97) Splicing factor, arginine/serine-rich 4| Length = 489 Score = 30.8 bits (68), Expect = 1.5 Identities = 15/43 (34%), Positives = 29/43 (67%) Frame = -3 Query: 435 NRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQN 307 ++S+ P+ ++ + S S+ +SRS SPSR S+SPS ++ ++ Sbjct: 443 SKSKPNVPAESRSRSKSASKTRSRSKSPSRSASRSPSRSRSRS 485
>CWC21_USTMA (Q4P0G6) Pre-mRNA-splicing factor CWC21| Length = 348 Score = 30.4 bits (67), Expect = 2.0 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 3/40 (7%) Frame = -3 Query: 435 NRSQSPNPSRCQNLNPSQSRCQSRSLSPSRC---QSQSPS 325 +RS+S + S + S+SR SRS SPSRC +S+SP+ Sbjct: 285 SRSRSRSRSPLSHSRSSRSRSPSRSRSPSRCASSRSRSPA 324
>NCAP_CVCAE (Q04700) Nucleocapsid protein (N structural protein) (NC)| Length = 382 Score = 30.4 bits (67), Expect = 2.0 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = -3 Query: 417 NPSRCQNLNPSQSRCQSRSLSPSRCQSQS 331 N SR + +PSQSR QSR+ S SR + QS Sbjct: 154 NQSRDNSRSPSQSRSQSRNRSQSRGRQQS 182
>CWC22_MAGGR (Q52B63) Pre-mRNA-splicing factor CWC22| Length = 907 Score = 30.4 bits (67), Expect = 2.0 Identities = 18/44 (40%), Positives = 26/44 (59%) Frame = -3 Query: 435 NRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQNQ 304 +RS+SP P R ++ + S SR +SRS S S +S +P Q Q Sbjct: 714 SRSRSPAPIRGRSYSRSVSRSRSRSYSRSVSRSPTPPRRQAPAQ 757
>NKTR_HUMAN (P30414) NK-tumor recognition protein (Natural-killer cells| cyclophilin-related protein) (NK-TR protein) Length = 1462 Score = 30.0 bits (66), Expect = 2.6 Identities = 16/37 (43%), Positives = 27/37 (72%) Frame = -3 Query: 429 SQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLT 319 SQS +PSR ++ + ++SR ++RS+S S +S+S S T Sbjct: 1309 SQSRSPSRSRSKSETKSRHRTRSVSYSHSRSRSRSST 1345
>SFRS4_HUMAN (Q08170) Splicing factor, arginine/serine-rich 4 (Pre-mRNA-splicing| factor SRP75) (SRP001LB) Length = 494 Score = 30.0 bits (66), Expect = 2.6 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = -3 Query: 435 NRSQSPN-PSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQN 307 N PN PS ++ + S S+ +SRS S SR S+SPS ++ ++ Sbjct: 447 NSKSKPNLPSESRSRSKSASKTRSRSKSRSRSASRSPSRSRSRS 490
>RSP1_CAEEL (Q23121) Probable splicing factor, arginine/serine-rich 1| (RNA-binding protein srp-5) (CeSRp75) Length = 312 Score = 29.6 bits (65), Expect = 3.4 Identities = 17/37 (45%), Positives = 25/37 (67%) Frame = -3 Query: 435 NRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 325 +RS+SP P R + + S+SR +SRS S +S+SPS Sbjct: 236 SRSRSP-PKRSRRESKSKSRSRSRSRSADNRKSRSPS 271
>GUX1_HUMGT (P15828) Exoglucanase 1 precursor (EC 3.2.1.91) (Exoglucanase I)| (Exocellobiohydrolase I) (1,4-beta-cellobiohydrolase) (Beta-glucancellobiohydrolase) Length = 525 Score = 29.6 bits (65), Expect = 3.4 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -3 Query: 210 TIDVMLTYDSRRRRRSTPSGATMCYFQNKW 121 T+ +T DS R SG+T CY NKW Sbjct: 45 TVQASITLDSNWRWTHQVSGSTNCYTGNKW 74
>SFR16_HUMAN (Q8N2M8) Splicing factor, arginine/serine-rich 16 (Suppressor of| white-apricot homolog 2) Length = 659 Score = 29.6 bits (65), Expect = 3.4 Identities = 20/39 (51%), Positives = 24/39 (61%), Gaps = 4/39 (10%) Frame = -3 Query: 429 SQSPNPSRCQNLNPSQSRC----QSRSLSPSRCQSQSPS 325 S S +PSR ++L S+S QSRS S SR QS SPS Sbjct: 482 SWSLSPSRSRSLTRSRSHSPSPSQSRSRSRSRSQSPSPS 520 Score = 28.9 bits (63), Expect = 5.8 Identities = 16/36 (44%), Positives = 24/36 (66%) Frame = -3 Query: 432 RSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 325 RS+S +PS Q+ + S+SR QS S SP+R + P+ Sbjct: 495 RSRSHSPSPSQSRSRSRSRSQSPSPSPAREKLTRPA 530 Score = 28.9 bits (63), Expect = 5.8 Identities = 18/37 (48%), Positives = 24/37 (64%) Frame = -3 Query: 435 NRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 325 +RS+S SR + +PSQSR +SRS +SQSPS Sbjct: 488 SRSRSLTRSRSHSPSPSQSRSRSRS------RSQSPS 518
>SFRS6_HUMAN (Q13247) Splicing factor, arginine/serine-rich 6 (Pre-mRNA-splicing| factor SRP55) Length = 344 Score = 29.3 bits (64), Expect = 4.4 Identities = 17/40 (42%), Positives = 25/40 (62%), Gaps = 3/40 (7%) Frame = -3 Query: 435 NRSQSP---NPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 325 +RS SP PS+ ++++P R SRS S SR +S+S S Sbjct: 299 SRSNSPLPVPPSKARSVSPPPKRATSRSRSRSRSKSRSRS 338
>CWC22_YARLI (Q6C8C5) Pre-mRNA-splicing factor CWC22| Length = 954 Score = 29.3 bits (64), Expect = 4.4 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = -3 Query: 435 NRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 325 +R ++ +P R + + S SR SRS S SR S+SPS Sbjct: 838 SRDRTGSPPRGRRRSRSYSRSPSRSYSRSRSYSRSPS 874
>VE2_HPV17 (P36785) Regulatory protein E2| Length = 452 Score = 29.3 bits (64), Expect = 4.4 Identities = 17/35 (48%), Positives = 22/35 (62%) Frame = -3 Query: 429 SQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 325 S+SPN R + +R QSRSLS SR +S+S S Sbjct: 296 SRSPNRGRGGSSGGPTTRSQSRSLSRSRSRSRSRS 330
>RSP3_CAEEL (Q9NEW6) Probable splicing factor, arginine/serine-rich 3 (CeSF2)| (CeSF2/ASF) Length = 258 Score = 29.3 bits (64), Expect = 4.4 Identities = 17/36 (47%), Positives = 23/36 (63%) Frame = -3 Query: 432 RSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 325 R SP S ++ + S+SR +SRS S SR S+SPS Sbjct: 221 RRASPKYSPRRSRSRSRSRSRSRSRSASRSPSRSPS 256
>VE2_HPV21 (P50767) Regulatory protein E2| Length = 503 Score = 28.5 bits (62), Expect = 7.6 Identities = 17/39 (43%), Positives = 25/39 (64%) Frame = -3 Query: 432 RSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQ 316 RS+S + SR ++ + +SR +SRS S SR +SQS Q Sbjct: 266 RSRSKSRSRSRSRSRLRSRSRSRSRSYSRSRSQSSDQPQ 304
>RPM1_CAEEL (Q17551) Ubiquitin ligase protein rpm-1 (EC 6.3.2.-)| (Pam/highwire/rpm-1 protein) (Regulator of presynaptic morphology protein 1) (Synapse defective protein 3) Length = 3766 Score = 28.1 bits (61), Expect = 9.9 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +3 Query: 105 LAGYYATYSGNSTSWLRTGSISSSFGCHM*ASH 203 L+G+ +T +G WL TGS+ + C + SH Sbjct: 1963 LSGHTSTSAGFLAKWLPTGSVVDASKCQLSLSH 1995
>UAFA_STAS1 (Q4A0V8) Uro-adherence factor A precursor| Length = 2316 Score = 28.1 bits (61), Expect = 9.9 Identities = 16/41 (39%), Positives = 26/41 (63%) Frame = -3 Query: 429 SQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQN 307 SQS + S ++L+ S+S +S SLS S S S SL++ ++ Sbjct: 854 SQSLSLSASESLSESESLSESESLSESESLSASESLSESES 894 Score = 28.1 bits (61), Expect = 9.9 Identities = 18/41 (43%), Positives = 25/41 (60%) Frame = -3 Query: 429 SQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQN 307 SQS + S +L+ S+S QS SLS S SQS SL+ ++ Sbjct: 824 SQSLSLSHSLSLSESESTSQSLSLSTSESLSQSLSLSASES 864
>GUX1_NEUCR (P38676) Exoglucanase 1 precursor (EC 3.2.1.91)| (Exocellobiohydrolase 1) (1,4-beta-cellobiohydrolase) Length = 516 Score = 28.1 bits (61), Expect = 9.9 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -3 Query: 210 TIDVMLTYDSRRRRRSTPSGATMCYFQNKWHS 115 T++ + D+ R SG+T CY NKW + Sbjct: 43 TLNTTMVLDANWRWTHATSGSTKCYTGNKWQA 74
>VE2_HPV25 (P36787) Regulatory protein E2| Length = 502 Score = 28.1 bits (61), Expect = 9.9 Identities = 15/32 (46%), Positives = 23/32 (71%) Frame = -3 Query: 426 QSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQS 331 +S + SR ++ + S+SR +SRS S SR +SQS Sbjct: 266 RSRSKSRSRSRSQSRSRIRSRSRSRSRSESQS 297 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,141,996 Number of Sequences: 219361 Number of extensions: 577061 Number of successful extensions: 2044 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 1810 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2010 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)