| Clone Name | rbaet66b11 |
|---|---|
| Clone Library Name | barley_pub |
>XTH8_ORYSA (Q76BW5) Xyloglucan endotransglycosylase/hydrolase protein 8| precursor (EC 2.4.1.207) (End-xyloglucan transferase) (OsXTH8) (OsXRT5) Length = 290 Score = 43.9 bits (102), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 283 YCADGWRFPKGFPGECGRK 227 YCADGWRFP+GFP EC RK Sbjct: 272 YCADGWRFPQGFPAECYRK 290
>XTH25_ARATH (Q38907) Probable xyloglucan endotransglucosylase/hydrolase protein| 25 precursor (EC 2.4.1.207) (At-XTH25) (XTH-25) Length = 284 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 283 YCADGWRFPKGFPGEC 236 YC D RFP+GFP EC Sbjct: 267 YCTDTKRFPQGFPKEC 282
>XTH15_ARATH (Q38911) Probable xyloglucan endotransglucosylase/hydrolase protein| 15 precursor (EC 2.4.1.207) (At-XTH15) (XTH-15) Length = 289 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 283 YCADGWRFPKGFPGEC 236 YC+D RFP+GFP EC Sbjct: 269 YCSDLKRFPRGFPPEC 284
>XTH16_ARATH (Q8LG58) Probable xyloglucan endotransglucosylase/hydrolase protein| 16 precursor (EC 2.4.1.207) (At-XTH16) (XTH-16) Length = 291 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 283 YCADGWRFPKGFPGEC 236 YC+D RFP+GFP EC Sbjct: 271 YCSDLKRFPQGFPPEC 286
>BRU1_SOYBN (P35694) Brassinosteroid-regulated protein BRU1 precursor| Length = 283 Score = 29.6 bits (65), Expect = 2.1 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -1 Query: 283 YCADGWRFPKGFPGECGR 230 YC+D RFP+G P EC R Sbjct: 266 YCSDLKRFPQGLPAECKR 283
>XTH23_ARATH (Q38910) Probable xyloglucan endotransglucosylase/hydrolase protein| 23 precursor (EC 2.4.1.207) (At-XTH23) (XTH-23) Length = 286 Score = 28.9 bits (63), Expect = 3.5 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -1 Query: 283 YCADGWRFPKGFPGEC 236 YC D RFP+G P EC Sbjct: 268 YCTDAKRFPQGLPREC 283
>XTH22_ARATH (Q38857) Xyloglucan endotransglucosylase/hydrolase protein 22| precursor (EC 2.4.1.207) (At-XTH22) (XTH-22) (Touch protein 4) Length = 284 Score = 28.9 bits (63), Expect = 3.5 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -1 Query: 283 YCADGWRFPKGFPGEC 236 YC D RFP+G P EC Sbjct: 266 YCTDAKRFPQGLPKEC 281
>XTH17_ARATH (O80803) Probable xyloglucan endotransglucosylase/hydrolase protein| 17 precursor (EC 2.4.1.207) (At-XTH17) (XTH-17) Length = 282 Score = 28.9 bits (63), Expect = 3.5 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -1 Query: 283 YCADGWRFPKGFPGEC 236 YC D RFP+G P EC Sbjct: 266 YCTDKRRFPRGVPAEC 281
>ABFA_BACST (Q9XBQ3) Alpha-N-arabinofuranosidase (EC 3.2.1.55) (Arabinosidase)| Length = 501 Score = 28.5 bits (62), Expect = 4.6 Identities = 9/31 (29%), Positives = 20/31 (64%) Frame = -2 Query: 159 GAAEQNCPSFCSFHDSIIGHVHVFLPYITLH 67 G++ +N P+F + +++ H + + YI+LH Sbjct: 213 GSSNRNMPTFAEWEATVLDHTYDHVDYISLH 243
>XTH19_ARATH (Q9M0D1) Probable xyloglucan endotransglucosylase/hydrolase protein| 19 precursor (EC 2.4.1.207) (At-XTH19) (XTH-19) Length = 277 Score = 28.5 bits (62), Expect = 4.6 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 283 YCADGWRFPKGFPGEC 236 YC+D RFP+G P EC Sbjct: 261 YCSDKKRFPRGVPPEC 276
>SRJ38_CAEEL (O16975) Serpentine receptor class J-38 (Protein srj-38)| Length = 330 Score = 28.1 bits (61), Expect = 6.0 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 3/47 (6%) Frame = -3 Query: 158 VLQNKIALLFVRFMIPLLDMYMSSYLTLH---YITGPIFLPCMYIFA 27 ++ + ALL V F+ L +Y SS LH Y+TG + L Y A Sbjct: 98 LVASSYALLLVHFIYRFLVIYDSSLTRLHFHWYMTGSLLLSVAYFVA 144
>XTH12_ARATH (Q9FKL9) Probable xyloglucan endotransglucosylase/hydrolase protein| 12 precursor (EC 2.4.1.207) (At-XTH12) (XTH-12) Length = 285 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -1 Query: 283 YCADGWRFPKGFPGEC 236 YC D RFP+G P EC Sbjct: 267 YCTDFKRFPQGLPTEC 282
>XTH13_ARATH (Q9FKL8) Putative xyloglucan endotransglucosylase/hydrolase protein| 13 precursor (EC 2.4.1.207) (At-XTH13) (XTH-13) Length = 284 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -1 Query: 283 YCADGWRFPKGFPGEC 236 YC D RFP+G P EC Sbjct: 266 YCTDFKRFPQGLPTEC 281
>XTH14_ARATH (Q9ZSU4) Xyloglucan endotransglucosylase/hydrolase protein 14| precursor (EC 2.4.1.207) (At-XTH14) (XTH-14) Length = 287 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -1 Query: 283 YCADGWRFPKGFPGEC 236 YC D RFP+G P EC Sbjct: 270 YCTDFKRFPQGLPKEC 285 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,323,116 Number of Sequences: 219361 Number of extensions: 612799 Number of successful extensions: 1203 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1177 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1203 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)