| Clone Name | rbaet66b08 |
|---|---|
| Clone Library Name | barley_pub |
>RBS3_WHEAT (P07398) Ribulose bisphosphate carboxylase small chain clone 512| (EC 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 113 Score = 74.7 bits (182), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA 226 DAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA Sbjct: 80 DAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA 113
>RBS_HORVU (Q40004) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 174 Score = 73.6 bits (179), Expect = 1e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA 226 DAYVRIIGFDNMRQVQCVSFIAFKPPGC+ESGKA Sbjct: 141 DAYVRIIGFDNMRQVQCVSFIAFKPPGCQESGKA 174
>RBS2_WHEAT (P26667) Ribulose bisphosphate carboxylase small chain PW9,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PW9) Length = 175 Score = 73.2 bits (178), Expect = 2e-13 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA 226 DAYVR+IGFDNMRQVQCVSFIAF+PPGCEESGKA Sbjct: 142 DAYVRVIGFDNMRQVQCVSFIAFRPPGCEESGKA 175
>RBS1_WHEAT (P00871) Ribulose bisphosphate carboxylase small chain PWS4.3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PWS4.3) Length = 174 Score = 72.0 bits (175), Expect = 3e-13 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA 226 DAYVR+IGFDN+RQVQCVSFIAF+PPGCEESGKA Sbjct: 141 DAYVRVIGFDNLRQVQCVSFIAFRPPGCEESGKA 174
>RBS_AEGTA (Q38793) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 63.9 bits (154), Expect = 9e-11 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA 226 D Y RIIGFDNMRQVQ VSFIA KPPGCEESGKA Sbjct: 142 DPYCRIIGFDNMRQVQSVSFIASKPPGCEESGKA 175
>RBS3_ORYSA (P18567) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 175 Score = 62.8 bits (151), Expect = 2e-10 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPPGCEESG 232 DA+VRIIGFDN+RQVQ +SFIA+KPPGCEESG Sbjct: 142 DAFVRIIGFDNVRQVQLISFIAYKPPGCEESG 173
>RBS2_ORYSA (P18566) Ribulose bisphosphate carboxylase small chain A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit A) Length = 175 Score = 62.4 bits (150), Expect = 3e-10 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPPGCEESG 232 DA++RIIGFDN+RQVQ +SFIA+KPPGCEESG Sbjct: 142 DAFIRIIGFDNVRQVQLISFIAYKPPGCEESG 173
>RBS1_ORYSA (P05347) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 172 Score = 53.5 bits (127), Expect = 1e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPPGCEESG 232 DA+VRIIGFDN+RQVQ +SFIA+ PGCEESG Sbjct: 140 DAFVRIIGFDNVRQVQLISFIAYN-PGCEESG 170
>RBS3_AMAHP (Q9XGX4) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 180 Score = 53.5 bits (127), Expect = 1e-07 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKPPG 247 A++RIIGFDN RQVQCVSFIAFKPPG Sbjct: 154 AFIRIIGFDNKRQVQCVSFIAFKPPG 179
>RBS_MANES (Q42915) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 53.1 bits (126), Expect = 2e-07 Identities = 21/27 (77%), Positives = 25/27 (92%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPPG 247 D Y RIIGFDN+RQVQC+SF+A+KPPG Sbjct: 155 DGYARIIGFDNVRQVQCISFLAYKPPG 181
>RBS2_PETHY (P04715) Ribulose bisphosphate carboxylase small chain SSU11A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU11A) Length = 180 Score = 52.8 bits (125), Expect = 2e-07 Identities = 21/27 (77%), Positives = 27/27 (100%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPPG 247 +A++RIIGFDN+RQVQC+SFIA+KPPG Sbjct: 153 NAWIRIIGFDNVRQVQCISFIAYKPPG 179
>RBS1_PETHY (P04714) Ribulose bisphosphate carboxylase small chain SSU8,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU8) Length = 180 Score = 52.8 bits (125), Expect = 2e-07 Identities = 21/27 (77%), Positives = 27/27 (100%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPPG 247 +A++RIIGFDN+RQVQC+SFIA+KPPG Sbjct: 153 NAWIRIIGFDNVRQVQCISFIAYKPPG 179
>RBS1_SOYBN (P00865) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 178 Score = 51.6 bits (122), Expect = 5e-07 Identities = 20/27 (74%), Positives = 26/27 (96%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPPG 247 + ++RIIGFDN+RQVQC+SFIA+KPPG Sbjct: 151 NGFIRIIGFDNVRQVQCISFIAYKPPG 177
>RBS_HEVBR (P29684) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 50.8 bits (120), Expect = 8e-07 Identities = 21/29 (72%), Positives = 25/29 (86%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPPGCE 241 D Y RIIGFDN+RQVQC+SF+A+KP G E Sbjct: 155 DCYGRIIGFDNVRQVQCISFLAYKPKGAE 183
>RBS3B_ARATH (P10798) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 181 Score = 50.8 bits (120), Expect = 8e-07 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKPPGCEES 235 A++RIIGFDN RQVQC+SFIA+KPP E+ Sbjct: 152 AFIRIIGFDNTRQVQCISFIAYKPPSFTEA 181
>RBS2B_ARATH (P10797) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 181 Score = 50.8 bits (120), Expect = 8e-07 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKPPGCEES 235 A++RIIGFDN RQVQC+SFIA+KPP E+ Sbjct: 152 AFIRIIGFDNTRQVQCISFIAYKPPSFTEA 181
>RBS_GLYTA (Q42823) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 50.8 bits (120), Expect = 8e-07 Identities = 20/26 (76%), Positives = 26/26 (100%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPP 250 +A++RIIGFDN+RQVQC+SFIA+KPP Sbjct: 151 NAFIRIIGFDNVRQVQCISFIAYKPP 176
>RBS_MAIZE (P05348) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 170 Score = 50.4 bits (119), Expect = 1e-06 Identities = 20/29 (68%), Positives = 26/29 (89%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPPGCE 241 DA+ R+IGFDN++Q QCVSFIA+KPPG + Sbjct: 142 DAFHRVIGFDNIKQTQCVSFIAYKPPGSD 170
>RBS_GOSHI (P31333) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 50.1 bits (118), Expect = 1e-06 Identities = 20/27 (74%), Positives = 26/27 (96%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPPG 247 +A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 155 NAFIRIIGFDNVRQVQCISFIAYKPKG 181
>RBS1A_ARATH (P10795) Ribulose bisphosphate carboxylase small chain 1A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1A) Length = 180 Score = 50.1 bits (118), Expect = 1e-06 Identities = 20/26 (76%), Positives = 25/26 (96%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPP 250 +A++RIIGFDN RQVQC+SFIA+KPP Sbjct: 151 NAFIRIIGFDNTRQVQCISFIAYKPP 176
>RBS2_BRANA (P27985) Ribulose bisphosphate carboxylase small chain F1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit F1) Length = 181 Score = 49.7 bits (117), Expect = 2e-06 Identities = 20/26 (76%), Positives = 25/26 (96%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPP 250 +A++RIIGFDN RQVQC+SFIA+KPP Sbjct: 151 NAFIRIIGFDNNRQVQCISFIAYKPP 176
>RBS1_LYCES (P08706) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) (LESS17) Length = 181 Score = 49.7 bits (117), Expect = 2e-06 Identities = 21/26 (80%), Positives = 25/26 (96%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKPPG 247 A+VRIIGFDN+RQVQC+SFIA+KP G Sbjct: 155 AWVRIIGFDNVRQVQCISFIAYKPEG 180
>RBS1_BRANA (P05346) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 49.7 bits (117), Expect = 2e-06 Identities = 20/26 (76%), Positives = 25/26 (96%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPP 250 +A++RIIGFDN RQVQC+SFIA+KPP Sbjct: 151 NAFIRIIGFDNNRQVQCISFIAYKPP 176
>RBS1B_ARATH (P10796) Ribulose bisphosphate carboxylase small chain 1B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1B) Length = 181 Score = 49.7 bits (117), Expect = 2e-06 Identities = 20/25 (80%), Positives = 24/25 (96%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKPP 250 A++RIIGFDN RQVQC+SFIA+KPP Sbjct: 152 AFIRIIGFDNTRQVQCISFIAYKPP 176
>RBS_SINAL (P13951) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 82 Score = 49.7 bits (117), Expect = 2e-06 Identities = 20/26 (76%), Positives = 25/26 (96%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPP 250 +A++RIIGFDN RQVQC+SFIA+KPP Sbjct: 52 NAFIRIIGFDNNRQVQCISFIAYKPP 77
>RBS_STELP (Q41351) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 49.7 bits (117), Expect = 2e-06 Identities = 20/25 (80%), Positives = 25/25 (100%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKP 253 DA++RIIGFDN+RQVQC+SFIA+KP Sbjct: 153 DAHIRIIGFDNVRQVQCISFIAYKP 177
>RBS8_NICPL (P26573) Ribulose bisphosphate carboxylase small chain 8B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 8B) Length = 180 Score = 49.7 bits (117), Expect = 2e-06 Identities = 21/26 (80%), Positives = 25/26 (96%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKPPG 247 A+VRIIGFDN+RQVQC+SFIA+KP G Sbjct: 154 AWVRIIGFDNVRQVQCISFIAYKPEG 179
>RBS3B_LYCES (P05349) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 180 Score = 49.7 bits (117), Expect = 2e-06 Identities = 21/26 (80%), Positives = 25/26 (96%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKPPG 247 A+VRIIGFDN+RQVQC+SFIA+KP G Sbjct: 154 AWVRIIGFDNVRQVQCISFIAYKPEG 179
>RBS3A_LYCES (P07180) Ribulose bisphosphate carboxylase small chain 3A/3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A/3C) Length = 180 Score = 49.7 bits (117), Expect = 2e-06 Identities = 21/26 (80%), Positives = 25/26 (96%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKPPG 247 A+VRIIGFDN+RQVQC+SFIA+KP G Sbjct: 154 AWVRIIGFDNVRQVQCISFIAYKPEG 179
>RBS2A_LYCES (P07179) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) (LESS 5) Length = 180 Score = 49.7 bits (117), Expect = 2e-06 Identities = 21/26 (80%), Positives = 25/26 (96%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKPPG 247 A+VRIIGFDN+RQVQC+SFIA+KP G Sbjct: 154 AWVRIIGFDNVRQVQCISFIAYKPEG 179
>RBS_CUCSA (P08474) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 49.7 bits (117), Expect = 2e-06 Identities = 19/25 (76%), Positives = 25/25 (100%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKP 253 DA++R+IGFDN+RQVQC+SFIA+KP Sbjct: 155 DAFIRVIGFDNVRQVQCISFIAYKP 179
>RBS1_AMAHP (Q42516) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 183 Score = 49.3 bits (116), Expect = 2e-06 Identities = 21/26 (80%), Positives = 24/26 (92%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKPPG 247 A++RIIGFDN RQVQCVSFIA+KP G Sbjct: 156 AFIRIIGFDNKRQVQCVSFIAYKPAG 181
>RBS_LACSA (Q40250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 49.3 bits (116), Expect = 2e-06 Identities = 19/27 (70%), Positives = 25/27 (92%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPPG 247 +A++R+IGFDN+RQVQC+SFI KPPG Sbjct: 153 NAFIRVIGFDNIRQVQCISFIVAKPPG 179
>RBS3_SOLTU (P32764) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 181 Score = 49.3 bits (116), Expect = 2e-06 Identities = 20/26 (76%), Positives = 25/26 (96%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKPPG 247 A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 155 AWIRIIGFDNVRQVQCISFIAYKPEG 180
>RBS2_NICSY (P22433) Ribulose bisphosphate carboxylase small chain S41,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit S41) Length = 181 Score = 49.3 bits (116), Expect = 2e-06 Identities = 20/26 (76%), Positives = 25/26 (96%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKPPG 247 A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 155 AWIRIIGFDNVRQVQCISFIAYKPEG 180
>RBS1_SOLTU (P26574) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 181 Score = 49.3 bits (116), Expect = 2e-06 Identities = 20/26 (76%), Positives = 25/26 (96%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKPPG 247 A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 155 AWIRIIGFDNVRQVQCISFIAYKPEG 180
>RBS0_SOLTU (P10647) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 181 Score = 49.3 bits (116), Expect = 2e-06 Identities = 20/26 (76%), Positives = 25/26 (96%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKPPG 247 A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 155 AWIRIIGFDNVRQVQCISFIAYKPEG 180
>RBS_SILPR (P18960) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 177 Score = 49.3 bits (116), Expect = 2e-06 Identities = 21/25 (84%), Positives = 24/25 (96%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKP 253 DA+VRIIGFDN RQVQC+SFIA+KP Sbjct: 152 DAHVRIIGFDNKRQVQCISFIAYKP 176
>RBS_GLYTO (Q42822) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 49.3 bits (116), Expect = 2e-06 Identities = 19/26 (73%), Positives = 25/26 (96%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPP 250 + ++RIIGFDN+RQVQC+SFIA+KPP Sbjct: 151 NGFIRIIGFDNVRQVQCISFIAYKPP 176
>RBS4_SOYBN (P12468) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 49.3 bits (116), Expect = 2e-06 Identities = 19/26 (73%), Positives = 25/26 (96%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPP 250 + ++RIIGFDN+RQVQC+SFIA+KPP Sbjct: 151 NGFIRIIGFDNVRQVQCISFIAYKPP 176
>RBS_TOBAC (P69249) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (TSSU3-8) Length = 180 Score = 49.3 bits (116), Expect = 2e-06 Identities = 20/26 (76%), Positives = 25/26 (96%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKPPG 247 A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 154 AWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBSC_SOLTU (P26577) Ribulose bisphosphate carboxylase small chain 2C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2C) Length = 180 Score = 49.3 bits (116), Expect = 2e-06 Identities = 20/26 (76%), Positives = 25/26 (96%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKPPG 247 A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 154 AWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBSB_SOLTU (P26576) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 180 Score = 49.3 bits (116), Expect = 2e-06 Identities = 20/26 (76%), Positives = 25/26 (96%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKPPG 247 A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 154 AWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBSA_SOLTU (P26575) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) Length = 180 Score = 49.3 bits (116), Expect = 2e-06 Identities = 20/26 (76%), Positives = 25/26 (96%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKPPG 247 A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 154 AWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBS1_NICSY (P69250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 49.3 bits (116), Expect = 2e-06 Identities = 20/26 (76%), Positives = 25/26 (96%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKPPG 247 A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 154 AWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBS6_MESCR (Q08186) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 186 Score = 48.9 bits (115), Expect = 3e-06 Identities = 20/25 (80%), Positives = 25/25 (100%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKP 253 +A++RIIGFDN+RQVQCVSFIA+KP Sbjct: 157 EAFIRIIGFDNVRQVQCVSFIAYKP 181
>RBS5_MESCR (Q08185) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 182 Score = 48.9 bits (115), Expect = 3e-06 Identities = 20/25 (80%), Positives = 25/25 (100%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKP 253 +A++RIIGFDN+RQVQCVSFIA+KP Sbjct: 153 EAFIRIIGFDNVRQVQCVSFIAYKP 177
>RBS4_MESCR (Q08184) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 183 Score = 48.9 bits (115), Expect = 3e-06 Identities = 20/25 (80%), Positives = 25/25 (100%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKP 253 +A++RIIGFDN+RQVQCVSFIA+KP Sbjct: 154 EAFIRIIGFDNVRQVQCVSFIAYKP 178
>RBS_PYRPY (P24007) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 48.5 bits (114), Expect = 4e-06 Identities = 19/26 (73%), Positives = 25/26 (96%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKPPG 247 +++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 157 SFIRIIGFDNVRQVQCISFIAYKPAG 182
>RBS_MALSP (Q02980) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 48.5 bits (114), Expect = 4e-06 Identities = 19/26 (73%), Positives = 25/26 (96%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKPPG 247 +++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 157 SFIRIIGFDNVRQVQCISFIAYKPAG 182
>RBS3_MESCR (Q08183) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 183 Score = 48.5 bits (114), Expect = 4e-06 Identities = 19/25 (76%), Positives = 25/25 (100%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKP 253 +A++RIIGFDN+RQVQC+SFIA+KP Sbjct: 154 EAFIRIIGFDNVRQVQCISFIAYKP 178
>RBS1_MESCR (P16032) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 182 Score = 48.5 bits (114), Expect = 4e-06 Identities = 19/25 (76%), Positives = 25/25 (100%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKP 253 +A++RIIGFDN+RQVQC+SFIA+KP Sbjct: 153 EAFIRIIGFDNVRQVQCISFIAYKP 177
>RBS_MUSAC (O24045) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 48.5 bits (114), Expect = 4e-06 Identities = 20/26 (76%), Positives = 24/26 (92%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKPPG 247 A++RIIGFDN RQVQC+SFIA+KP G Sbjct: 154 AFIRIIGFDNNRQVQCISFIAYKPTG 179
>RBS_FAGCR (O22077) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 48.1 bits (113), Expect = 5e-06 Identities = 19/25 (76%), Positives = 24/25 (96%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKPP 250 +++RIIGFDN RQVQC+SFIA+KPP Sbjct: 156 SHIRIIGFDNKRQVQCISFIAYKPP 180
>RBS_BETVE (Q96542) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 48.1 bits (113), Expect = 5e-06 Identities = 20/26 (76%), Positives = 24/26 (92%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKPPG 247 A++RIIGFDN RQVQ +SFIA+KPPG Sbjct: 156 AFIRIIGFDNKRQVQIISFIAYKPPG 181
>RBS_RAPSA (P08135) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 48.1 bits (113), Expect = 5e-06 Identities = 20/26 (76%), Positives = 24/26 (92%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPP 250 +A +RIIGFDN RQVQC+SFIA+KPP Sbjct: 151 NALIRIIGFDNNRQVQCISFIAYKPP 176
>RBS_FLATR (P07089) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 173 Score = 47.8 bits (112), Expect = 7e-06 Identities = 21/26 (80%), Positives = 24/26 (92%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKPPG 247 A++RIIGFDN+RQVQCVSFIA KP G Sbjct: 147 AWIRIIGFDNVRQVQCVSFIASKPTG 172
>RBS4_FLAPR (Q39746) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 47.4 bits (111), Expect = 9e-06 Identities = 20/26 (76%), Positives = 24/26 (92%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKPPG 247 A++RIIGFDN+RQVQC+SFIA KP G Sbjct: 152 AWIRIIGFDNVRQVQCISFIASKPDG 177
>RBS2_FLAPR (Q39744) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 178 Score = 47.4 bits (111), Expect = 9e-06 Identities = 20/26 (76%), Positives = 24/26 (92%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKPPG 247 A++RIIGFDN+RQVQC+SFIA KP G Sbjct: 152 AWIRIIGFDNVRQVQCISFIASKPEG 177
>RBS7_FLAPR (Q39749) Ribulose bisphosphate carboxylase small chain 7,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 7) Length = 173 Score = 47.4 bits (111), Expect = 9e-06 Identities = 20/26 (76%), Positives = 24/26 (92%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKPPG 247 A++RIIGFDN+RQVQC+SFIA KP G Sbjct: 147 AWIRIIGFDNVRQVQCISFIASKPDG 172
>RBS5_FLAPR (Q39747) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 173 Score = 47.4 bits (111), Expect = 9e-06 Identities = 20/26 (76%), Positives = 24/26 (92%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKPPG 247 A++RIIGFDN+RQVQC+SFIA KP G Sbjct: 147 AWIRIIGFDNVRQVQCISFIASKPDG 172
>RBS3_FLAPR (Q39745) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 173 Score = 47.4 bits (111), Expect = 9e-06 Identities = 20/26 (76%), Positives = 24/26 (92%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKPPG 247 A++RIIGFDN+RQVQC+SFIA KP G Sbjct: 147 AWIRIIGFDNVRQVQCISFIASKPDG 172
>RBS2_SPIOL (Q43832) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 47.4 bits (111), Expect = 9e-06 Identities = 20/27 (74%), Positives = 25/27 (92%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPPG 247 +A++RIIGFD+ RQVQCVSFIA+KP G Sbjct: 153 NAFIRIIGFDSNRQVQCVSFIAYKPAG 179
>RBS2_MESCR (Q04450) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 47.4 bits (111), Expect = 9e-06 Identities = 19/25 (76%), Positives = 24/25 (96%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKP 253 +A+ RIIGFDN+RQVQC+SFIA+KP Sbjct: 151 EAFTRIIGFDNVRQVQCISFIAYKP 175
>RBS2_AMAHP (Q9XGX5) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 184 Score = 47.4 bits (111), Expect = 9e-06 Identities = 20/24 (83%), Positives = 23/24 (95%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKP 253 A++RIIGFDN RQVQCVSFIA+KP Sbjct: 157 AFIRIIGFDNKRQVQCVSFIAYKP 180
>RBS_CAPAN (O65349) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 187 Score = 47.4 bits (111), Expect = 9e-06 Identities = 19/24 (79%), Positives = 24/24 (100%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKP 253 A++RIIGFDN+RQVQC+SFIA+KP Sbjct: 154 AWIRIIGFDNVRQVQCISFIAYKP 177
>RBS1_FLAPR (Q39743) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 173 Score = 47.0 bits (110), Expect = 1e-05 Identities = 20/26 (76%), Positives = 24/26 (92%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKPPG 247 A++RIIGFDN+RQVQC+SFIA KP G Sbjct: 147 AWIRIIGFDNVRQVQCISFIASKPGG 172
>RBS6_LEMGI (P19312) Ribulose bisphosphate carboxylase small chain SSU5B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5B) Length = 177 Score = 45.8 bits (107), Expect = 3e-05 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = -3 Query: 321 YVRIIGFDNMRQVQCVSFIAFKP 253 +VRIIGFDN RQVQC+SFIA+KP Sbjct: 154 FVRIIGFDNKRQVQCISFIAYKP 176
>RBS5_LEMGI (P19311) Ribulose bisphosphate carboxylase small chain SSU5A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5A) Length = 177 Score = 45.8 bits (107), Expect = 3e-05 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = -3 Query: 321 YVRIIGFDNMRQVQCVSFIAFKP 253 +VRIIGFDN RQVQC+SFIA+KP Sbjct: 154 FVRIIGFDNKRQVQCISFIAYKP 176
>RBS4_LEMGI (P19310) Ribulose bisphosphate carboxylase small chain SSU40B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40B) Length = 177 Score = 45.8 bits (107), Expect = 3e-05 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = -3 Query: 321 YVRIIGFDNMRQVQCVSFIAFKP 253 +VRIIGFDN RQVQC+SFIA+KP Sbjct: 154 FVRIIGFDNKRQVQCISFIAYKP 176
>RBS3_LEMGI (P19309) Ribulose bisphosphate carboxylase small chain SSU40A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40A) Length = 177 Score = 45.8 bits (107), Expect = 3e-05 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = -3 Query: 321 YVRIIGFDNMRQVQCVSFIAFKP 253 +VRIIGFDN RQVQC+SFIA+KP Sbjct: 154 FVRIIGFDNKRQVQCISFIAYKP 176
>RBS2_LEMGI (P19308) Ribulose bisphosphate carboxylase small chain SSU26,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU26) Length = 177 Score = 45.8 bits (107), Expect = 3e-05 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = -3 Query: 321 YVRIIGFDNMRQVQCVSFIAFKP 253 +VRIIGFDN RQVQC+SFIA+KP Sbjct: 154 FVRIIGFDNKRQVQCISFIAYKP 176
>RBS1_LEMGI (P00872) Ribulose bisphosphate carboxylase small chain SSU1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU1) Length = 173 Score = 45.8 bits (107), Expect = 3e-05 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = -3 Query: 321 YVRIIGFDNMRQVQCVSFIAFKP 253 +VRIIGFDN RQVQC+SFIA+KP Sbjct: 150 FVRIIGFDNKRQVQCISFIAYKP 172
>RBS6_FLAPR (Q39748) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 173 Score = 45.4 bits (106), Expect = 3e-05 Identities = 19/24 (79%), Positives = 23/24 (95%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKP 253 A++RIIGFDN+RQVQC+SFIA KP Sbjct: 147 AWIRIIGFDNVRQVQCISFIASKP 170
>RBS1_SPIOL (P00870) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 123 Score = 45.1 bits (105), Expect = 5e-05 Identities = 18/27 (66%), Positives = 24/27 (88%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPPG 247 DA+VR IGF++ R+VQC+SFIA+KP G Sbjct: 96 DAFVRFIGFNDKREVQCISFIAYKPAG 122
>RBS_MEDSA (O65194) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 45.1 bits (105), Expect = 5e-05 Identities = 18/25 (72%), Positives = 23/25 (92%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKP 253 D+++RIIGFDN+RQVQC+SFIA P Sbjct: 153 DSFIRIIGFDNVRQVQCISFIAHTP 177
>RBS_LARLA (P16031) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 44.7 bits (104), Expect = 6e-05 Identities = 17/25 (68%), Positives = 23/25 (92%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKP 253 +A++R+IGFDN+RQVQC+SFI KP Sbjct: 162 NAFIRVIGFDNVRQVQCISFIVHKP 186
>RBS_ZANAE (O48550) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 44.3 bits (103), Expect = 8e-05 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPPG 247 D + RIIGFDN RQVQC+SF+ +KP G Sbjct: 151 DYFNRIIGFDNTRQVQCISFLTYKPEG 177
>RBS_TRIRP (P17673) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 44.3 bits (103), Expect = 8e-05 Identities = 18/25 (72%), Positives = 23/25 (92%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKP 253 +A++RIIGFDN+RQVQC+SFIA P Sbjct: 151 EAFIRIIGFDNVRQVQCISFIASTP 175
>RBS_HELAN (P08705) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 44.3 bits (103), Expect = 8e-05 Identities = 18/26 (69%), Positives = 23/26 (88%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKPPG 247 A++RIIGFDN+RQVQC+ FIA +P G Sbjct: 152 AWIRIIGFDNVRQVQCIMFIASRPDG 177
>RBS3_PEA (P07689) Ribulose bisphosphate carboxylase small chain 3A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A) Length = 180 Score = 44.3 bits (103), Expect = 8e-05 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKP 253 A+VRIIGFDN+RQVQC+SFIA P Sbjct: 154 AFVRIIGFDNVRQVQCISFIAHTP 177
>RBS2_PEA (P00869) Ribulose bisphosphate carboxylase small chain 3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3C) (PSS15) Length = 180 Score = 44.3 bits (103), Expect = 8e-05 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKP 253 A+VRIIGFDN+RQVQC+SFIA P Sbjct: 154 AFVRIIGFDNVRQVQCISFIAHTP 177
>RBS_PINTH (P10053) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 171 Score = 44.3 bits (103), Expect = 8e-05 Identities = 17/24 (70%), Positives = 22/24 (91%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKP 253 A++R+IGFDN+RQVQC+SFI KP Sbjct: 147 AFIRVIGFDNVRQVQCISFIVHKP 170
>RBS5_FRIAG (O22645) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 179 Score = 43.9 bits (102), Expect = 1e-04 Identities = 18/24 (75%), Positives = 22/24 (91%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKP 253 A++R+IGFDN+RQVQCVSFI KP Sbjct: 155 AFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS3_FRIAG (O22573) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 179 Score = 43.9 bits (102), Expect = 1e-04 Identities = 18/24 (75%), Positives = 22/24 (91%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKP 253 A++R+IGFDN+RQVQCVSFI KP Sbjct: 155 AFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS2_FRIAG (O22572) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 179 Score = 43.9 bits (102), Expect = 1e-04 Identities = 18/24 (75%), Positives = 22/24 (91%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKP 253 A++R+IGFDN+RQVQCVSFI KP Sbjct: 155 AFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS1_FRIAG (O24634) Ribulose bisphosphate carboxylase small chain 1/4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1/4) Length = 179 Score = 42.7 bits (99), Expect = 2e-04 Identities = 17/24 (70%), Positives = 22/24 (91%) Frame = -3 Query: 324 AYVRIIGFDNMRQVQCVSFIAFKP 253 A++R+IGFDN+RQVQCVSFI +P Sbjct: 155 AFIRVIGFDNVRQVQCVSFIVERP 178
>RBS1_PEA (P00868) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (PSSU1) (Fragment) Length = 136 Score = 42.7 bits (99), Expect = 2e-04 Identities = 17/25 (68%), Positives = 23/25 (92%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKP 253 +A+VR+IGF+N+RQVQC+SFIA P Sbjct: 109 EAFVRVIGFNNVRQVQCISFIAHTP 133
>RBS_SYNP2 (Q44178) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 111 Score = 41.2 bits (95), Expect = 7e-04 Identities = 15/25 (60%), Positives = 21/25 (84%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKP 253 D Y+R++GFDN++Q Q VSFI +KP Sbjct: 82 DCYIRVVGFDNIKQCQTVSFIVYKP 106
>RBS_MARPA (O64416) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 38.5 bits (88), Expect = 0.004 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = -3 Query: 321 YVRIIGFDNMRQVQCVSFIAFKP 253 Y+R +GFDN RQVQC SFI +P Sbjct: 156 YIRCLGFDNTRQVQCASFIVHQP 178
>RBS_SYNY3 (P54206) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 113 Score = 38.1 bits (87), Expect = 0.006 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKP 253 + Y+R+IGFDN++Q Q VSFI KP Sbjct: 82 NCYIRVIGFDNIKQCQTVSFIVHKP 106
>RBS_PROHO (P27569) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 109 Score = 37.7 bits (86), Expect = 0.007 Identities = 14/25 (56%), Positives = 20/25 (80%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKP 253 + Y+R++GFDN++Q Q VSFI KP Sbjct: 82 NCYIRVVGFDNIKQCQSVSFIVHKP 106
>RBS_SYNP6 (P04716) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 110 Score = 37.0 bits (84), Expect = 0.012 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKP 253 D Y+R+ GFDN++Q Q VSFI +P Sbjct: 83 DCYIRVAGFDNIKQCQTVSFIVHRP 107
>RBS_SACHY (Q41373) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 168 Score = 37.0 bits (84), Expect = 0.012 Identities = 15/24 (62%), Positives = 20/24 (83%) Frame = -3 Query: 312 IIGFDNMRQVQCVSFIAFKPPGCE 241 I+GFDN+RQ Q ++FIA+KP G E Sbjct: 145 ILGFDNIRQTQWLTFIAYKPAGSE 168
>RBS_ANASP (P06514) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 109 Score = 36.2 bits (82), Expect = 0.021 Identities = 13/23 (56%), Positives = 19/23 (82%) Frame = -3 Query: 321 YVRIIGFDNMRQVQCVSFIAFKP 253 Y+R++GFDN++Q Q +SFI KP Sbjct: 84 YIRVVGFDNIKQCQILSFIVHKP 106
>RBS_CHLMO (P17537) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 168 Score = 36.2 bits (82), Expect = 0.021 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 238 + Y+R++ FDN++QVQC+ F+ +P E Sbjct: 130 NVYIRLVAFDNVKQVQCMGFLVQRPRNAAE 159
>RBS_CYAPA (P18062) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 106 Score = 35.8 bits (81), Expect = 0.027 Identities = 12/25 (48%), Positives = 21/25 (84%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKP 253 +AY+R++ FD++RQVQ + F+ +KP Sbjct: 81 NAYIRVVAFDSIRQVQTLMFLVYKP 105
>RBS2_CHLRE (P08475) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 185 Score = 35.4 bits (80), Expect = 0.036 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 238 DAYVR++ FDN +QVQ + F+ +P + Sbjct: 147 DAYVRLVAFDNQKQVQIMGFLVQRPKSARD 176
>RBS1_CHLRE (P00873) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 185 Score = 35.0 bits (79), Expect = 0.047 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKP 253 DAYVR++ FDN +QVQ + F+ +P Sbjct: 147 DAYVRLVAFDNQKQVQIMGFLVQRP 171
>RBS_EUGGR (P16881) Ribulose bisphosphate carboxylase small chains, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulose bisphosphate carboxylase small chain P2; Ribulose bispho Length = 1273 Score = 33.9 bits (76), Expect = 0.10 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = -3 Query: 321 YVRIIGFDNMRQVQCVSFIAFKPPGCEES 235 YVR+ FD+++QVQ +SF+ +P G S Sbjct: 1100 YVRLAAFDSVKQVQVISFVVQRPSGSSSS 1128 Score = 33.9 bits (76), Expect = 0.10 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = -3 Query: 321 YVRIIGFDNMRQVQCVSFIAFKPPGCEES 235 YVR+ FD+++QVQ +SF+ +P G S Sbjct: 812 YVRLAAFDSVKQVQVISFVVQRPSGSSSS 840 Score = 33.9 bits (76), Expect = 0.10 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = -3 Query: 321 YVRIIGFDNMRQVQCVSFIAFKPPGCEES 235 YVR+ FD+++QVQ +SF+ +P G S Sbjct: 669 YVRLAAFDSVKQVQVISFVVQRPSGSSSS 697 Score = 33.9 bits (76), Expect = 0.10 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = -3 Query: 321 YVRIIGFDNMRQVQCVSFIAFKPPGCEES 235 YVR+ FD+++QVQ +SF+ +P G S Sbjct: 525 YVRLAAFDSVKQVQVISFVVQRPSGSSSS 553 Score = 33.9 bits (76), Expect = 0.10 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = -3 Query: 321 YVRIIGFDNMRQVQCVSFIAFKPPGCEES 235 YVR+ FD+++QVQ +SF+ +P G S Sbjct: 382 YVRLAAFDSVKQVQVISFVVQRPSGSSSS 410 Score = 33.9 bits (76), Expect = 0.10 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = -3 Query: 321 YVRIIGFDNMRQVQCVSFIAFKPPGCEES 235 YVR+ FD+++QVQ +SF+ +P G S Sbjct: 238 YVRLAAFDSVKQVQVISFVVQRPSGSSSS 266 Score = 30.8 bits (68), Expect = 0.88 Identities = 11/23 (47%), Positives = 18/23 (78%) Frame = -3 Query: 321 YVRIIGFDNMRQVQCVSFIAFKP 253 YVR+ FD+++QVQ +SF+ +P Sbjct: 1244 YVRLAAFDSVKQVQVISFVVQRP 1266 Score = 29.6 bits (65), Expect = 2.0 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = -3 Query: 321 YVRIIGFDNMRQVQCVSFIAFKPPGCEES 235 YVR+ FD+++QVQ +SF+ +P G S Sbjct: 957 YVRL-AFDSVKQVQVISFVVQRPSGSSSS 984
>RBS7_ACECL (Q38693) Ribulose bisphosphate carboxylase small chain 7,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 7) (rbcS1) Length = 183 Score = 33.9 bits (76), Expect = 0.10 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 238 DAY+R++ FD RQVQ F+ +PP + Sbjct: 145 DAYIRLVCFDANRQVQICGFLVHRPPSATD 174
>RBS6_ACECL (Q38692) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) (rbcS4) Length = 182 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 238 DAY+R++ FD RQVQ F+ +PP + Sbjct: 144 DAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS4_ACEME (P16137) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 182 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 238 DAY+R++ FD RQVQ F+ +PP + Sbjct: 144 DAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS4_ACECL (P16132) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 182 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 238 DAY+R++ FD RQVQ F+ +PP + Sbjct: 144 DAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS3_ACEME (P16136) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 182 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 238 DAY+R++ FD RQVQ F+ +PP + Sbjct: 144 DAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS1_ACEME (P16134) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 182 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 238 DAY+R++ FD RQVQ F+ +PP + Sbjct: 144 DAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS2_ACECL (P16130) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) (Fragment) Length = 86 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 238 DAY+R++ FD RQVQ F+ +PP + Sbjct: 48 DAYIRLVCFDANRQVQISGFLVHRPPSATD 77
>RBS5_ACEME (P16138) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 183 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 238 DAY+R++ FD RQVQ F+ +PP + Sbjct: 145 DAYIRLVCFDANRQVQISGFLVHRPPSATD 174
>RBS3_ACECL (P16131) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 183 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 238 DAY+R++ FD RQVQ F+ +PP + Sbjct: 145 DAYIRLVCFDANRQVQISGFLVHRPPSATD 174
>RBS2_ACEME (P16135) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) (Fragment) Length = 173 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 238 DAY+R++ FD RQVQ F+ +PP + Sbjct: 135 DAYIRLVCFDANRQVQISGFLVHRPPSATD 164
>RBS1_ACECL (P16129) Ribulose bisphosphate carboxylase small chain 1 (EC| 4.1.1.39) (RuBisCO small subunit 1) (Fragment) Length = 126 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 238 DAY+R++ FD RQVQ F+ +PP + Sbjct: 88 DAYIRLVCFDANRQVQISGFLVHRPPSATD 117
>RBS5_ACECL (P16133) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 184 Score = 33.1 bits (74), Expect = 0.18 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKPP 250 DAY+R++ FD RQVQ F+ +PP Sbjct: 146 DAYIRLVCFDANRQVQISGFLVHRPP 171
>DPO1_BACST (P52026) DNA polymerase I (EC 2.7.7.7) (POL I)| Length = 876 Score = 31.6 bits (70), Expect = 0.52 Identities = 17/48 (35%), Positives = 29/48 (60%) Frame = -2 Query: 325 RLCPHHRIRQHASGAVRQLHRLQATRLRGVWQGLNKLTPFYHTTWFRA 182 +L PHH I +H RQL +LQ+T + G+ + ++ +T HT + +A Sbjct: 563 KLAPHHEIVEHILH-YRQLGKLQSTYIEGLLKVVHPVTGKVHTMFNQA 609
>RBS_BATOE (P26985) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 30.4 bits (67), Expect = 1.2 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -3 Query: 327 DAYVRIIGFDNMRQVQCVSFIAFKP 253 DAY+R++ FD RQVQ F+ +P Sbjct: 137 DAYIRLVCFDANRQVQISGFLVHRP 161
>PCD10_HUMAN (Q9P2E7) Protocadherin-10 precursor| Length = 1040 Score = 29.6 bits (65), Expect = 2.0 Identities = 11/27 (40%), Positives = 21/27 (77%) Frame = -1 Query: 230 RPKQANSLLSYNMVSCQVHFISLFTFV 150 R + AN+ L+Y+++ CQ+ +S+FT+V Sbjct: 490 RDEGANAQLAYSILECQIQGMSVFTYV 516
>RN139_HUMAN (Q8WU17) RING finger protein 139 (Translocation in renal carcinoma| on chromosome 8) Length = 664 Score = 28.9 bits (63), Expect = 3.4 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = -3 Query: 171 YFPFYFCSACVCVLSLQLELTLYEYYNHKSTTTTFG*GACKLRLCIK 31 +FP F SAC+ +L + L L+ +Y T F A + LC+K Sbjct: 389 HFPVLFVSACLFILPVLLSYVLWHHY--ALNTWLFAVTAFCVELCLK 433
>RN139_MOUSE (Q7TMV1) RING finger protein 139| Length = 668 Score = 28.9 bits (63), Expect = 3.4 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = -3 Query: 171 YFPFYFCSACVCVLSLQLELTLYEYYNHKSTTTTFG*GACKLRLCIK 31 +FP F SAC+ +L + L L+ +Y T F A + LC+K Sbjct: 389 HFPVLFVSACLFILPVLLSYVLWHHY--ALNTWLFAVTAFCVELCLK 433
>DPO1_BACCA (Q04957) DNA polymerase I (EC 2.7.7.7) (POL I)| Length = 877 Score = 28.5 bits (62), Expect = 4.4 Identities = 15/48 (31%), Positives = 27/48 (56%) Frame = -2 Query: 325 RLCPHHRIRQHASGAVRQLHRLQATRLRGVWQGLNKLTPFYHTTWFRA 182 +L P+H I ++ RQL +LQ+T + G+ + + T HT + +A Sbjct: 563 KLAPYHEIVENILQHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQA 610
>ZN268_HUMAN (Q14587) Zinc finger protein 268 (Zinc finger protein HZF3)| Length = 947 Score = 28.1 bits (61), Expect = 5.7 Identities = 18/53 (33%), Positives = 24/53 (45%) Frame = -3 Query: 258 KPPGCEESGKA*TS*LPFIIQHGFVPGSFYFPFYFCSACVCVLSLQLELTLYE 100 KP C E GKA T I+ G G Y CS C SL+ +L +++ Sbjct: 638 KPYSCNECGKAFTFKSQLIVHKGVHTG---VKPYGCSQCAKTFSLKSQLIVHQ 687
>RBS_PSEHY (Q51857) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 124 Score = 27.7 bits (60), Expect = 7.5 Identities = 8/22 (36%), Positives = 17/22 (77%) Frame = -3 Query: 318 VRIIGFDNMRQVQCVSFIAFKP 253 +++IG+DN+RQ Q + + ++P Sbjct: 101 IKLIGYDNIRQTQGTAMLVYRP 122
>LGT_LACJO (P60971) Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-)| Length = 278 Score = 27.3 bits (59), Expect = 9.8 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = -3 Query: 207 FIIQHGFVPGSFYFPFYFCSACVCVLSLQLELTL 106 FIIQ ++ GS+Y P Y + + ++ L L L+L Sbjct: 161 FIIQQMYINGSYYQPTYLYESTLNLIGLILILSL 194
>VE6_HPV11 (P04019) Protein E6| Length = 150 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -3 Query: 168 FPFYFCSACVCVLSLQLELTLYEYYNHKSTTTT 70 FPF +AC C L LQ ++ Y ++N+ + T Sbjct: 59 FPF---AACACCLELQGKINQYRHFNYAAYAPT 88 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,292,015 Number of Sequences: 219361 Number of extensions: 701669 Number of successful extensions: 1552 Number of sequences better than 10.0: 122 Number of HSP's better than 10.0 without gapping: 1520 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1551 length of database: 80,573,946 effective HSP length: 85 effective length of database: 61,928,261 effective search space used: 1486278264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)