| Clone Name | rbaet66a10 |
|---|---|
| Clone Library Name | barley_pub |
>ALGB_PSEAE (P23747) Alginate biosynthesis transcriptional regulatory protein| algB Length = 449 Score = 30.0 bits (66), Expect = 1.5 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +3 Query: 21 NTALESNEASILDYLCKPCIPD 86 +TA+++ +A +DYL KPC PD Sbjct: 93 DTAVDAMQAGAVDYLVKPCSPD 114
>ALGB_PSESM (Q88AQ2) Alginate biosynthesis transcriptional regulatory protein| algB Length = 448 Score = 28.9 bits (63), Expect = 3.4 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +3 Query: 21 NTALESNEASILDYLCKPCIPD 86 +TA+++ +A DYL KPC PD Sbjct: 93 DTAVDAIQAGAADYLVKPCSPD 114
>ALGB_PSEPK (Q88RJ6) Alginate biosynthesis transcriptional regulatory protein| algB Length = 448 Score = 28.9 bits (63), Expect = 3.4 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +3 Query: 21 NTALESNEASILDYLCKPCIPD 86 +TA+++ +A DYL KPC PD Sbjct: 93 DTAVDAIQAGAADYLVKPCSPD 114
>VND_DROME (P22808) Homeobox protein vnd (Protein ventral nervous system| defective) (Homeobox protein NK-2) Length = 723 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 5/41 (12%) Frame = +1 Query: 196 AKHEQILEHNAPSKLLGCRDYYHYEQHH-----PENNHQQA 303 A H EH+AP + +H + HH P+ +HQQA Sbjct: 279 ADHHSTTEHHAPPSHPQQQHPHHQQHHHPHLLLPQQHHQQA 319
>YRM5_CAEEL (Q09601) Hypothetical protein R06F6.5| Length = 378 Score = 27.7 bits (60), Expect = 7.7 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +1 Query: 133 ETWIYIPD*LHSKIKL*RNLSAKHEQILEHNAPSK 237 +TW+ + S++ + NL ++H +++ H PSK Sbjct: 198 DTWVTVFGFQPSQVSILLNLFSRHGEVVSHQTPSK 232 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,074,062 Number of Sequences: 219361 Number of extensions: 610691 Number of successful extensions: 1199 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1187 length of database: 80,573,946 effective HSP length: 77 effective length of database: 63,683,149 effective search space used: 1528395576 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)