| Clone Name | rbaet65f11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TMP14_ARATH (Q8LCA1) Thylakoid membrane phosphoprotein 14 kDa, c... | 35 | 0.062 | 2 | VGLI_VZVD (P09258) Glycoprotein I precursor (Glycoprotein IV) (G... | 33 | 0.40 | 3 | NEC1_MUSCO (P63240) Neuroendocrine convertase 1 precursor (EC 3.... | 29 | 5.8 | 4 | NEC1_MOUSE (P63239) Neuroendocrine convertase 1 precursor (EC 3.... | 29 | 5.8 | 5 | SEC16_SCHPO (O14029) Multidomain vesicle coat protein | 28 | 9.9 |
|---|
>TMP14_ARATH (Q8LCA1) Thylakoid membrane phosphoprotein 14 kDa, chloroplast| precursor Length = 174 Score = 35.4 bits (80), Expect = 0.062 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = -2 Query: 379 YTGWFVYRYLLFKESRKELATDIESFKKKIAGT 281 YTGWF Y+ L+FK R+ L ++S K I G+ Sbjct: 141 YTGWFTYKNLVFKPDREALFEKVKSTYKDILGS 173
>VGLI_VZVD (P09258) Glycoprotein I precursor (Glycoprotein IV) (GI) (GPIV)| Length = 354 Score = 32.7 bits (73), Expect = 0.40 Identities = 17/63 (26%), Positives = 34/63 (53%) Frame = +3 Query: 234 LDKRAIRNVPENRVYSVPAIFFLKLSMSVANSFLLSLKRR*RYTNHPVYPSPTSSRSLGS 413 L ++++ + PEN + +P + + + ++ ++S+KRR R HP+Y T +R Sbjct: 261 LPEKSLNDPPENLLIIIPIVASVMILTAMVIVIVISVKRR-RIKKHPIYRPNTKTRRGIQ 319 Query: 414 NGT 422 N T Sbjct: 320 NAT 322
>NEC1_MUSCO (P63240) Neuroendocrine convertase 1 precursor (EC 3.4.21.93) (NEC| 1) (PC1) (Prohormone convertase 1) (Proprotein convertase 1) (PC3) (Furin homolog) (Propeptide-processing protease) Length = 753 Score = 28.9 bits (63), Expect = 5.8 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 224 HYIIRQKSHPKRSREPSL 277 HY+ + KSHP+RSR +L Sbjct: 67 HYLFKHKSHPRRSRRSAL 84
>NEC1_MOUSE (P63239) Neuroendocrine convertase 1 precursor (EC 3.4.21.93) (NEC| 1) (PC1) (Prohormone convertase 1) (Proprotein convertase 1) (PC3) (Furin homolog) (Propeptide-processing protease) Length = 753 Score = 28.9 bits (63), Expect = 5.8 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 224 HYIIRQKSHPKRSREPSL 277 HY+ + KSHP+RSR +L Sbjct: 67 HYLFKHKSHPRRSRRSAL 84
>SEC16_SCHPO (O14029) Multidomain vesicle coat protein| Length = 1995 Score = 28.1 bits (61), Expect = 9.9 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +3 Query: 264 ENRVYSVPAIFFLKLSMSVANSFLLSLKRR*RYTNHPVYPS 386 ENRVY+ ++ L LS V ++ SL + H +YPS Sbjct: 1396 ENRVYAAHLVYILSLSPDVCSNKSNSLFELVGLSKHNLYPS 1436 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,234,606 Number of Sequences: 219361 Number of extensions: 1169037 Number of successful extensions: 4064 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3903 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4064 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)