| Clone Name | rbaet65e10 |
|---|---|
| Clone Library Name | barley_pub |
>CB2C_LYCES (P14275) Chlorophyll a-b binding protein 1C, chloroplast precursor| (LHCII type I CAB-1C) (LHCP) (Fragments) Length = 265 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN WAFA FVPG+ Sbjct: 246 LADPVNNNAWAFATNFVPGK 265
>CB2B_LYCES (P07370) Chlorophyll a-b binding protein 1B, chloroplast precursor| (LHCII type I CAB-1B) (LHCP) Length = 265 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN WAFA FVPG+ Sbjct: 246 LADPVNNNAWAFATNFVPGK 265
>CB2A_LYCES (P14274) Chlorophyll a-b binding protein 1A, chloroplast precursor| (LHCII type I CAB-1A) (LHCP) (Fragments) Length = 265 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN WAFA FVPG+ Sbjct: 246 LADPVNNNAWAFATNFVPGK 265
>CB2G_LYCES (P07369) Chlorophyll a-b binding protein 3C, chloroplast precursor| (LHCII type I CAB-3C) (LHCP) Length = 267 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN WAFA FVPG+ Sbjct: 248 LADPVNNNAWAFATNFVPGK 267
>CB22_ARATH (P04778) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (CAB-140) (LHCP) Length = 267 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN WAFA FVPG+ Sbjct: 248 LADPVNNNAWAFATNFVPGK 267
>CB21_ARATH (P04777) Chlorophyll a-b binding protein 165/180, chloroplast| precursor (LHCII type I CAB-165/180) Length = 267 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN WAFA FVPG+ Sbjct: 248 LADPVNNNAWAFATNFVPGK 267
>CB24_PETSP (P04782) Chlorophyll a-b binding protein 25, chloroplast precursor| (LHCII type I CAB-25) (LHCP) Length = 266 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN WAFA FVPG+ Sbjct: 247 LADPVNNNAWAFATNFVPGK 266
>CB23_APIGR (P92919) Chlorophyll a-b binding protein, chloroplast precursor| (Allergen Api g 3) Length = 264 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN WAFA FVPG+ Sbjct: 245 LADPVNNNAWAFATNFVPGK 264
>CB22_HORVU (P08963) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 264 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN WAFA FVPG+ Sbjct: 245 LADPVNNNAWAFATNFVPGK 264
>CB21_SINAL (P13851) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 266 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN WAFA FVPG+ Sbjct: 247 LADPVNNNAWAFATNFVPGK 266
>CB21_PETSP (P04779) Chlorophyll a-b binding protein 13, chloroplast precursor| (LHCII type I CAB-13) (LHCP) Length = 266 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN WAFA FVPG+ Sbjct: 247 LADPVNNNAWAFATNFVPGK 266
>CB21_RAPSA (P14584) Chlorophyll a-b binding of LHCII type 1 protein| (Chlorophyll a-b binding of LHCII type I protein) (CAB) (LHCP) (Fragment) Length = 124 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN WAFA FVPG+ Sbjct: 105 LADPVNNNAWAFATNFVPGK 124
>CB2F_LYCES (P14277) Chlorophyll a-b binding protein 3B, chloroplast precursor| (LHCII type I CAB-3B) (LHCP) (Fragments) Length = 267 Score = 38.9 bits (89), Expect = 0.004 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 +ADPVNNN WAFA FVPG+ Sbjct: 248 IADPVNNNAWAFATNFVPGK 267
>CB2E_LYCES (P14276) Chlorophyll a-b binding protein 3A, chloroplast precursor| (LHCII type I CAB-3A) (LHCP) (Fragments) Length = 267 Score = 38.9 bits (89), Expect = 0.004 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 +ADPVNNN WAFA FVPG+ Sbjct: 248 IADPVNNNAWAFATNFVPGK 267
>CB22_CUCSA (P08222) Chlorophyll a-b binding protein of LHCII type 1| (Chlorophyll a-b binding protein of LHCII type I) (CAB) (LHCP) (Fragment) Length = 206 Score = 38.5 bits (88), Expect = 0.005 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN WA+A FVPG+ Sbjct: 187 LADPVNNNAWAYATNFVPGK 206
>CB21_CUCSA (P08221) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) (Fragment) Length = 255 Score = 38.5 bits (88), Expect = 0.005 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN WA+A FVPG+ Sbjct: 236 LADPVNNNAWAYATNFVPGK 255
>CB22_ORYSA (P12331) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 261 Score = 38.5 bits (88), Expect = 0.005 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN WA+A FVPG+ Sbjct: 242 LADPVNNNAWAYATNFVPGK 261
>CB27_TOBAC (P27491) Chlorophyll a-b binding protein 7, chloroplast precursor| (LHCII type I CAB-7) (LHCP) Length = 267 Score = 38.5 bits (88), Expect = 0.005 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN WA+A FVPG+ Sbjct: 248 LADPVNNNAWAYATNFVPGK 267
>CB24_TOBAC (P27495) Chlorophyll a-b binding protein 40, chloroplast precursor| (LHCII type I CAB-40) (LHCP) Length = 267 Score = 38.5 bits (88), Expect = 0.005 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN WA+A FVPG+ Sbjct: 248 LADPVNNNAWAYATNFVPGK 267
>CB23_NICPL (P12469) Chlorophyll a-b binding protein C, chloroplast precursor| (LHCII type I CAB-C) (LHCP) Length = 267 Score = 38.5 bits (88), Expect = 0.005 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN WA+A FVPG+ Sbjct: 248 LADPVNNNAWAYATNFVPGK 267
>CB2A_PYRPY (P24006) Chlorophyll a-b binding protein 1A, chloroplast precursor| (LHCII type II CAB-1A) (LHCP) Length = 278 Score = 38.5 bits (88), Expect = 0.005 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN WA+A FVPG+ Sbjct: 259 LADPVNNNAWAYATNFVPGK 278
>CB2A_PINSY (P15193) Chlorophyll a-b binding protein type 2 member 1A,| chloroplast precursor (Chlorophyll a-b binding protein type II 1A) (CAB) (LHCP) Length = 278 Score = 38.5 bits (88), Expect = 0.005 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN WA+A FVPG+ Sbjct: 259 LADPVNNNAWAYATNFVPGK 278
>CB2B_PINSY (P15194) Chlorophyll a-b binding protein type 2 member 1B,| chloroplast precursor (Chlorophyll a-b binding protein type II 1B) (CAB) (LHCP) Length = 274 Score = 38.5 bits (88), Expect = 0.005 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN WA+A FVPG+ Sbjct: 255 LADPVNNNAWAYATNFVPGK 274
>CB29_MAIZE (P27497) Chlorophyll a-b binding protein M9, chloroplast precursor| (LHCII type I CAB-M9) (LHCP) Length = 265 Score = 38.5 bits (88), Expect = 0.005 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN WA+A FVPG+ Sbjct: 246 LADPVNNNAWAYATNFVPGK 265
>CB22_TOBAC (P27493) Chlorophyll a-b binding protein 21, chloroplast precursor| (LHCII type I CAB-21) (LHCP) Length = 265 Score = 38.5 bits (88), Expect = 0.005 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN WA+A FVPG+ Sbjct: 246 LADPVNNNAWAYATNFVPGK 265
>CB21_ORYSA (P12330) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 265 Score = 38.5 bits (88), Expect = 0.005 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN WA+A FVPG+ Sbjct: 246 LADPVNNNAWAYATNFVPGK 265
>CB22_MAIZE (P06671) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 265 Score = 37.7 bits (86), Expect = 0.008 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 +ADPVNNN WA+A FVPG+ Sbjct: 246 IADPVNNNAWAYATNFVPGK 265
>CB21_PEA (P04159) Chlorophyll a-b binding protein AB96 (LHCII type I| CAB-AB96) (LHCP) (Major 15) (Fragment) Length = 228 Score = 37.4 bits (85), Expect = 0.011 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN W++A FVPG+ Sbjct: 209 LADPVNNNAWSYATNFVPGK 228
>CB22_PEA (P07371) Chlorophyll a-b binding protein AB80, chloroplast| precursor (LHCII type I CAB-AB80) (LHCP) Length = 269 Score = 37.4 bits (85), Expect = 0.011 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN W++A FVPG+ Sbjct: 250 LADPVNNNAWSYATNFVPGK 269
>CB2D_LYCES (P10707) Chlorophyll a-b binding protein 1D (LHCII type I CAB-1D)| (LHCP) (Fragment) Length = 116 Score = 37.4 bits (85), Expect = 0.011 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN W++A FVPG+ Sbjct: 97 LADPVNNNAWSYATNFVPGK 116
>CB21_MAIZE (P12329) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 262 Score = 37.4 bits (85), Expect = 0.011 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPG 126 +ADPVNNN WA+A FVPG Sbjct: 243 IADPVNNNAWAYATNFVPG 261
>CB2A_SPIOL (P12333) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 267 Score = 37.4 bits (85), Expect = 0.011 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN W FA FVPG+ Sbjct: 248 LADPVNNNAWNFATNFVPGK 267
>CB25_TOBAC (P27496) Chlorophyll a-b binding protein 50, chloroplast precursor| (LHCII type I CAB-50) (LHCP) Length = 267 Score = 37.4 bits (85), Expect = 0.011 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN W++A FVPG+ Sbjct: 248 LADPVNNNAWSYATNFVPGK 267
>CB25_PETSP (P04783) Chlorophyll a-b binding protein 91R, chloroplast precursor| (LHCII type I CAB-91R) (LHCP) Length = 267 Score = 37.4 bits (85), Expect = 0.011 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN W++A FVPG+ Sbjct: 248 LADPVNNNAWSYATNFVPGK 267
>CB25_NICPL (P12470) Chlorophyll a-b binding protein E, chloroplast precursor| (LHCII type I CAB-E) (LHCP) Length = 266 Score = 37.4 bits (85), Expect = 0.011 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN W++A FVPG+ Sbjct: 247 LADPVNNNAWSYATNFVPGK 266
>CB23_PETSP (P04781) Chlorophyll a-b binding protein 22R, chloroplast precursor| (LHCII type I CAB-22R) (LHCP) Length = 267 Score = 37.4 bits (85), Expect = 0.011 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN W++A FVPG+ Sbjct: 248 LADPVNNNAWSYATNFVPGK 267
>CB21_TOBAC (P27492) Chlorophyll a-b binding protein 16, chloroplast precursor| (LHCII type I CAB-16) (LHCP) Length = 266 Score = 37.4 bits (85), Expect = 0.011 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN W++A FVPG+ Sbjct: 247 LADPVNNNAWSYATNFVPGK 266
>CB23_PEA (P27520) Chlorophyll a-b binding protein 215, chloroplast precursor| (LHCII type II CAB-215) (LHCP) Length = 265 Score = 37.0 bits (84), Expect = 0.014 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 +ADPV NN WAFA FVPGQ Sbjct: 246 VADPVANNAWAFATNFVPGQ 265
>CB21_SOYBN (P12471) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) (Fragment) Length = 245 Score = 37.0 bits (84), Expect = 0.014 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LA+PVNNN WA+A FVPG+ Sbjct: 226 LAEPVNNNAWAYATNFVPGK 245
>CB48_MAIZE (Q00827) Chlorophyll a-b binding protein 48, chloroplast precursor| (LHCII type I CAB-48) (LHCP) Length = 264 Score = 37.0 bits (84), Expect = 0.014 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 L DPVNNN WA+A FVPG+ Sbjct: 245 LTDPVNNNAWAYATNFVPGK 264
>CB28_PEA (P27490) Chlorophyll a-b binding protein 8, chloroplast precursor| (LHCII type I CAB-8) Length = 268 Score = 36.2 bits (82), Expect = 0.025 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 L+DPVNNN W++A FVPG+ Sbjct: 249 LSDPVNNNAWSYATNFVPGK 268
>CB22_SOYBN (P09755) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 256 Score = 36.2 bits (82), Expect = 0.025 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPVNNN WA+A K PG+ Sbjct: 237 LADPVNNNAWAYATKLCPGK 256
>CB23_SOYBN (P09756) Chlorophyll a-b binding protein 3, chloroplast precursor| (LHCII type I CAB-3) (LHCP) Length = 263 Score = 35.8 bits (81), Expect = 0.032 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LA PVNNN WA+A FVPG+ Sbjct: 244 LAGPVNNNAWAYATNFVPGK 263
>CB21_LEMGI (P12328) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 264 Score = 35.8 bits (81), Expect = 0.032 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 +ADPV NN WAFA FVPG+ Sbjct: 245 IADPVANNAWAFATNFVPGK 264
>CB22_PINSY (P15192) Chlorophyll a-b binding protein type 2 member 2| (Chlorophyll a-b binding protein type II 2) (CAB) (LHCP) (Fragment) Length = 150 Score = 35.4 bits (80), Expect = 0.042 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPV NN WA+A FVPG+ Sbjct: 131 LADPVANNAWAYATNFVPGK 150
>CB26_PETSP (P12062) Chlorophyll a-b binding protein 37, chloroplast precursor| (LHCII type I CAB-37) (LHCP) Length = 265 Score = 35.4 bits (80), Expect = 0.042 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 +ADPV NN WAFA FVPG+ Sbjct: 246 VADPVANNAWAFATNFVPGK 265
>CB21_PINTH (P10049) Chlorophyll a-b binding protein type I, chloroplast| precursor (CAB) (LHCP) Length = 266 Score = 35.4 bits (80), Expect = 0.042 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPV NN WA+A FVPG+ Sbjct: 247 LADPVANNAWAYATNFVPGK 266
>CB21_GOSHI (P27518) Chlorophyll a-b binding protein 151, chloroplast precursor| (LHCII type II CAB-151) (LHCP) Length = 265 Score = 35.4 bits (80), Expect = 0.042 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADPV NN WA+A FVPG+ Sbjct: 246 LADPVANNAWAYATNFVPGK 265
>CB25_LYCES (P14279) Chlorophyll a-b binding protein 5, chloroplast precursor| (LHCII type I CAB-5) (LHCP) (Fragment) Length = 237 Score = 34.7 bits (78), Expect = 0.071 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 +ADPV NN WA+A FVPG+ Sbjct: 218 IADPVANNAWAYATNFVPGK 237
>CB21_WHEAT (P04784) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 266 Score = 34.7 bits (78), Expect = 0.071 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 +ADPVNNN W A FVPG+ Sbjct: 247 IADPVNNNAWLIATNFVPGK 266
>CB23_ORYSA (P27519) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 263 Score = 34.3 bits (77), Expect = 0.093 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 +ADPV NN WA+A FVPG+ Sbjct: 244 VADPVANNAWAYATNFVPGK 263
>CB23_TOBAC (P27494) Chlorophyll a-b binding protein 36, chloroplast precursor| (LHCII type I CAB-36) (LHCP) Length = 265 Score = 34.3 bits (77), Expect = 0.093 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 +ADPV NN WA+A FVPG+ Sbjct: 246 VADPVANNAWAYATNFVPGK 265
>CB22_PETSP (P04780) Chlorophyll a-b binding protein 22L, chloroplast precursor| (LHCII type I CAB-22L) (LHCP) Length = 267 Score = 33.1 bits (74), Expect = 0.21 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVP 129 L DPVNNN W++A FVP Sbjct: 248 LVDPVNNNAWSYATNFVP 265
>CB23_HORVU (P27523) Chlorophyll a-b binding protein of LHCII type III,| chloroplast precursor (CAB) Length = 268 Score = 32.7 bits (73), Expect = 0.27 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPG 126 L DPV NN W FA KF PG Sbjct: 249 LDDPVANNAWVFATKFAPG 267
>CB2_PHYPA (P20866) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 269 Score = 32.3 bits (72), Expect = 0.35 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPG 126 LADPV NN WA+AP PG Sbjct: 249 LADPVANNAWAYAPTSPPG 267
>CB24_LYCES (P14278) Chlorophyll a-b binding protein 4, chloroplast precursor| (LHCII type I CAB-4) (LHCP) Length = 265 Score = 32.3 bits (72), Expect = 0.35 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -1 Query: 176 DPVNNNGWAFAPKFVPGQ 123 DPV NN WA+A FVPG+ Sbjct: 248 DPVANNAWAYATNFVPGK 265
>CB23_POLMU (P15195) Chlorophyll a-b binding protein type 1 member F3,| chloroplast precursor (DE Chlorophyll a-b binding protein type I F3) (CAB-F3) (LHCP) Length = 265 Score = 32.0 bits (71), Expect = 0.46 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPGQ 123 LADP NN WA+A F PG+ Sbjct: 246 LADPAVNNAWAYATNFTPGK 265
>CB23_LYCES (P27489) Chlorophyll a-b binding protein 13, chloroplast precursor| (LHCII type III CAB-13) Length = 265 Score = 31.2 bits (69), Expect = 0.79 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -1 Query: 182 LADPVNNNGWAFAPKFVPG 126 L +PV NN W +A KFVPG Sbjct: 246 LDNPVANNAWVYATKFVPG 264
>YCXD_BACSU (Q08792) Hypothetical protein ycxD (ORF8)| Length = 444 Score = 27.7 bits (60), Expect = 8.7 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 70 SYIQSTHILMKTRFSRVYWPGTNLGAKAHPLLLT 171 +Y S+H++ FS++ +PG +GA P LT Sbjct: 271 AYDLSSHVIYLKSFSKMMFPGLRVGAAVLPEALT 304 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,092,883 Number of Sequences: 219361 Number of extensions: 400111 Number of successful extensions: 868 Number of sequences better than 10.0: 59 Number of HSP's better than 10.0 without gapping: 862 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 868 length of database: 80,573,946 effective HSP length: 37 effective length of database: 72,457,589 effective search space used: 1738982136 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)