| Clone Name | rbaet65d08 |
|---|---|
| Clone Library Name | barley_pub |
>BLT4_HORVU (P25307) BLT4 protein precursor| Length = 130 Score = 60.1 bits (144), Expect = 1e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 320 PTRSAPVSAALRSTDRTRAPHISSDRRLVG 231 PTRSAPVS ALRSTDRTRAPHISSDRRLVG Sbjct: 101 PTRSAPVSTALRSTDRTRAPHISSDRRLVG 130
>LYST_HUMAN (Q99698) Lysosomal trafficking regulator (Beige homolog)| Length = 3801 Score = 30.8 bits (68), Expect = 0.89 Identities = 16/47 (34%), Positives = 28/47 (59%), Gaps = 2/47 (4%) Frame = +2 Query: 152 TSSPLSLMEIITEDLFMYMYICVCDLNLPSVDRWRYG--EHVFDQWI 286 +SSP L+E +T+ +Y IC+ +LNL S + + HVF+ ++ Sbjct: 1251 SSSPNDLLENLTQGEIIYPEICMLELNLLSASKAKLDVLAHVFESFL 1297
>YHR3_VACCV (P17369) Hypothetical host range 27.4 kDa protein| Length = 237 Score = 29.6 bits (65), Expect = 2.0 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = -2 Query: 303 SVGCPKIH*SNTCSPYLQRSTLGRLRSHT--HIYIYMNKSSVMISMRERGEDV 151 S CP + N C PYL+ + R T H + NK S++ + E G DV Sbjct: 2 SYACPILSTINICLPYLKDINMIDKRGETLLHKAVRYNKQSLVSLLLESGSDV 54
>Y580_CLOAB (Q97LI1) UPF0229 protein CAC0580| Length = 391 Score = 29.3 bits (64), Expect = 2.6 Identities = 14/34 (41%), Positives = 23/34 (67%) Frame = +2 Query: 176 EIITEDLFMYMYICVCDLNLPSVDRWRYGEHVFD 277 E+ E++F Y+ + DLNLP++D+ +Y E V D Sbjct: 116 EVTIEEVFSYL---LEDLNLPNLDKKKYSEIVTD 146
>VHR1_COWPX (P12932) Host range protein 1| Length = 669 Score = 29.3 bits (64), Expect = 2.6 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = -2 Query: 303 SVGCPKIH*SNTCSPYLQRSTLGRLRSHT--HIYIYMNKSSVMISMRERGEDV 151 S CP + N C PYL+ + R T H + NK S++ + E G DV Sbjct: 433 SYACPILSTINFCLPYLKDINMIDKRGETLLHKAVRYNKQSLVSLLLESGSDV 485
>NLTP8_HORVU (Q43871) Nonspecific lipid-transfer protein Cw18 precursor (LTP| Cw-18) (PKG2316) Length = 115 Score = 28.9 bits (63), Expect = 3.4 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 321 PYTISASVGCPKIH 280 PYTISASV C KIH Sbjct: 102 PYTISASVDCSKIH 115
>POL_HV1JR (P20875) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1438 Score = 28.9 bits (63), Expect = 3.4 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 Query: 241 RRSLEIWGARVRSVDLRAADTGADRVG 321 RR L++WG S+ A+ GADR G Sbjct: 459 RRELQVWGRDSNSLSEAGAEAGADRQG 485
>PUR2_ARATH (P52420) Phosphoribosylamine--glycine ligase, chloroplast precursor| (EC 6.3.4.13) (GARS) (Glycinamide ribonucleotide synthetase) (Phosphoribosylglycinamide synthetase) Length = 532 Score = 28.9 bits (63), Expect = 3.4 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 6/61 (9%) Frame = +1 Query: 16 PYTISAHGTTYSKLPYVSPQRE*TNNQTLIQNRYNSER------PCRAGSAYVLPSLSHG 177 P+ +S + + LP+V+P + T N L +R++S R R S PSLS G Sbjct: 28 PFLLSLRFASSNSLPFVAPLKFSTTNHVLSNSRFSSNRIQRRLFLLRCVSEESQPSLSIG 87 Query: 178 D 180 + Sbjct: 88 N 88
>PHLX_RABIT (Q05017) Phospholipase AdRab-B precursor (EC 3.1.-.-)| Length = 1458 Score = 28.1 bits (61), Expect = 5.8 Identities = 16/52 (30%), Positives = 29/52 (55%) Frame = -1 Query: 274 EHVLPISPAIDAW*VEVTYTYIHIHE*ILCYDLHERERGGRTLSQLYMAAHC 119 E+V I A+D E+ T++++ E + LH+ ++GGR + L +HC Sbjct: 1227 EYVQHIQQALDVLYEELPRTFVNVVEVMELAGLHQ-DQGGRCATLLAAQSHC 1277
>HISX_SALPA (Q5PDP3) Histidinol dehydrogenase (EC 1.1.1.23) (HDH)| Length = 434 Score = 28.1 bits (61), Expect = 5.8 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = -2 Query: 273 NTCSPYLQRSTLGRLRSHTHIYIYMNKSSVMISMRERGEDV-R*ASSTWPLTVVSVL 106 N+CSP QR+ L R I S ++ +++ RG+DV R S+ + T V+ L Sbjct: 10 NSCSPEQQRALLTRPAISASDSITRTVSDILYNVKTRGDDVLREYSAKFDKTEVTAL 66
>YFNF_BACSU (O06484) Hypothetical protein yfnF| Length = 303 Score = 27.7 bits (60), Expect = 7.5 Identities = 11/30 (36%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +2 Query: 191 DLFMYMYICVCDLNLPSVD--RWRYGEHVF 274 D ++ VCD+ P V+ W YG+H F Sbjct: 197 DYMSELFPNVCDITTPGVNIGHWNYGQHTF 226
>ZEST_DROME (P09956) Regulatory protein zeste| Length = 574 Score = 27.3 bits (59), Expect = 9.9 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = -1 Query: 265 LPISPAIDAW*VEVTYTYIHIHE*ILCYDLHERER 161 LP++P A EV YT H+HE ++ D+ R++ Sbjct: 49 LPLTPRFTAEEKEVLYTLFHLHEEVI--DIKHRKK 81 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,544,516 Number of Sequences: 219361 Number of extensions: 975678 Number of successful extensions: 2614 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2576 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2613 length of database: 80,573,946 effective HSP length: 82 effective length of database: 62,586,344 effective search space used: 1502072256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)